KEGG   Streptomyces avermitilis: SAVERM_7245
Entry
SAVERM_7245       CDS       T00126                                 
Symbol
panD
Name
(GenBank) putative L-aspartate 1-decarboxylase
  KO
K01579  aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00410  beta-Alanine metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01240  Biosynthesis of cofactors
Module
sma_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_7245 (panD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_7245 (panD)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     SAVERM_7245 (panD)
SSDB
Motif
Pfam: Asp_decarbox RcpC
Other DBs
NCBI-ProteinID: BAC74956
NITE: SAV7245
UniProt: Q826E8
Position
8640232..8640651
AA seq 139 aa
MLRTMFKSKIHRATVTQADLHYVGSVTIDADLLDAADLLPGELVHIVDITNGARLETYVI
EGERGSGVVGINGAAAHLVHPGDLVIIISYAQVSDAEARALRPRVVHVDRDNRVVALGAD
PAEPVPGSDQARSPQAVTA
NT seq 420 nt   +upstreamnt  +downstreamnt
atgctgcgtaccatgttcaagtccaagatccaccgagccaccgtcacccaggccgacctg
cactacgtcggatccgtcaccatcgacgccgatcttctggacgccgccgatctgctgccc
ggcgagttggttcatatcgtcgacatcaccaacggtgcccgcctggagacgtacgtcatc
gagggcgagcgtggctccggagtcgtcgggatcaacggggcggcggcccatctcgtccac
cccggcgacctggtgatcatcatcagctacgctcaggtttccgacgccgaggcgagggca
ctgcggccgagggtcgtgcacgtggaccgcgacaaccgcgtcgtggccctgggcgcggac
ccggccgagccggtaccgggctcggaccaggcgcgcagcccgcaggccgtcaccgcctga

DBGET integrated database retrieval system