KEGG   Streptomyces avermitilis: SAVERM_947
Entry
SAVERM_947        CDS       T00126                                 
Symbol
aveBIII
Name
(GenBank) glucose-1-phosphate thymidyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
sma  Streptomyces avermitilis
Pathway
sma00521  Streptomycin biosynthesis
sma00523  Polyketide sugar unit biosynthesis
sma00525  Acarbose and validamycin biosynthesis
sma00541  O-Antigen nucleotide sugar biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    SAVERM_947 (aveBIII)
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAVERM_947 (aveBIII)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_947 (aveBIII)
   00525 Acarbose and validamycin biosynthesis
    SAVERM_947 (aveBIII)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     SAVERM_947 (aveBIII)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: BAC68657
NITE: SAV0947
UniProt: Q79ZM2
Position
complement(1205812..1206711)
AA seq 299 aa
MKGIVLAGGTGSRLYPLTRALSKQLLPVYDKPMIYYPLSVLMLGGIKDILVISSPDHLEQ
FRRLLGDGSRLGLNIDYAAQQRPGGIAEAFLIGADFIGQDQVSLVLGDNIFHGMGFSHLL
RSHTRDVDGCVLFGYAVTDPERYGVGEVDASGKLLSVEEKPTAPRSNLAITGLYLYDNDV
IEVARGIRSSARGELEITDVNRAYLAEGRARLVDLGRGFTWLDAGTHDSLMHAGQYVQVL
EKRQGVRIACLEEIAFRMGLIDADDCYLRGVELAGSGYGEYLMSIAAEAAVRSPGCAYS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaagggaatcgtgctcgcggggggaaccggctctcggctttacccgttgacccgtgcc
ctttccaagcagctgctccctgtctacgacaaacccatgatctactacccgctctccgtg
ttgatgctcggcggcataaaagacatcctggtgatttcctcacccgatcatctcgaacaa
ttccggagactgctcggagacggaagccgcctcgggctgaacatcgactacgccgcgcag
cagcgaccgggaggaatcgccgaggcattcctcatcggcgccgatttcatcggtcaggat
caggtgtcccttgtccttggggacaacatcttccatggcatgggcttttcgcacctgctg
cgcagccacacccgcgatgtcgacggctgtgtgttgttcggatacgcggtgacggatccc
gaacggtacggagtcggagaggtcgacgcctccggaaagctgctgtccgtcgaggagaaa
cccaccgccccccggtccaacctggcgatcacaggcctgtacctgtacgacaacgacgtg
atcgaggtggcccggggcatccgctcgtcggcccgcggcgagctggagatcaccgacgtc
aacagggcctacctcgccgaggggcgggcccggctggtggacctgggccggggcttcacc
tggctcgatgcggggacgcacgactcgctgatgcacgccgggcagtatgtgcaggtcctg
gagaagcgccagggagtacggatcgcctgtctcgaggagatcgccttccggatgggtctg
atcgacgcggacgactgctatctgcgcggggtcgaactggccggctccggctacggcgag
tatctgatgagtattgcggcggaagccgcggtgaggagcccgggatgcgcctactcgtga

DBGET integrated database retrieval system