KEGG   Streptomyces avermitilis: SAVERM_948
Entry
SAVERM_948        CDS       T00126                                 

Gene name
aveBIV
Definition
(GenBank) dTDP-4-keto-6-deoxy-L-hexose 4-reductase
  KO
K19857  dTDP-4-keto-6-deoxy-L-hexose 4-reductase
Organism
sma  Streptomyces avermitilis
Pathway
sma00523  Polyketide sugar unit biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00799  dTDP-L-oleandrose biosynthesis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAVERM_948 (aveBIV)
SSDB
Motif
Pfam: Epimerase RmlD_sub_bind NAD_binding_10 GDP_Man_Dehyd 3Beta_HSD Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: BAC68658
NITE: SAV0948
UniProt: Q79ZM1
Position
1206837..1207868
AA seq 343 aa
MGRFSVCPPRPTGILKSMLTTGMCDRPLVVVLGASGYIGSAVAAELARWPVLLRLVARRP
GVVPPGGAAETETRTADLTAASEVALAVTDADVVIHLVARLTQGAAWRAAESDPVAERVN
VGVMHDVVAALRSGRRAGPPPVVVFAGSVYQVGRPGRVDGSEPDEPVTAYARQKLDAERT
LKSATVEGVLRGISLRLPTVYGAGPGPQGNGVVQAMVLRALADEALTVWNGSVVERDLVH
VEDVAQAFVSCLAHADALAGRHWLLGSGRPVTVPHLFGAIAAGVSARTGRPAVPVTAVDP
PAMATAADFHGTVVDSSAFRAVTGWRPRLSLQEGLDHMVAAYV
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggggcggttttcggtgtgcccgccccggccgaccggaatactgaagagcatgctgacg
actgggatgtgcgaccgaccgctggtcgtcgtactcggagcctccggctatatcgggtcg
gccgtcgcggcggaactcgcccggtggccggtcctgttgcggctggtggcccggcgaccg
ggcgtcgttccgccgggcggcgccgcggagaccgagacgcgtacggccgacctgacggcg
gcgagcgaggtcgccctcgccgtgacggacgccgacgtggtgatccacctggtcgcgcgc
ctcacccagggagcggcatggcgggcggcggagagcgatccggtggccgagcgggtgaac
gtcggggtgatgcacgacgtcgtcgcggccctgcggtccgggcgccgcgccgggccgccc
ccggtggtggtgttcgccgggtcggtctaccaggtgggccgcccgggtcgggtcgacggc
agtgagccggacgagcccgtgacggcctatgcccgtcagaaactcgacgccgaacggacg
ttgaagtccgccacggtcgagggtgtcctgcgggggatctcgctgcggctgcccaccgtc
tacggcgcggggccgggcccgcagggcaacggcgtcgtgcaggcgatggtgctccgggcg
ctcgccgacgaggccctcaccgtgtggaacggaagcgtggtggagcgtgacctggtgcat
gtggaggatgtcgcgcaggccttcgtgagctgcctggcgcacgcggatgcgctcgccggg
cggcactggctgctcggcagcggtcgtcctgtgaccgtcccgcacctcttcggtgccatc
gccgccggcgtgtccgcccgcaccgggcgccccgcggtgcccgtgaccgcggtggaccct
ccggcgatggcgacggcggcggacttccacgggaccgtcgtcgactcctcggcgttccgc
gcggtcaccgggtggcggccgcggctgtcgcttcaggagggcctggaccacatggtggcg
gcttacgtgtag

DBGET integrated database retrieval system