KEGG   Streptomyces avermitilis: SAVERM_949
Entry
SAVERM_949        CDS       T00126                                 
Symbol
aveBV
Name
(GenBank) dTDP-4-keto-6-deoxyhexose 3,5-epimerase
  KO
K16438  5-epimerase [EC:5.1.3.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00523  Polyketide sugar unit biosynthesis
sma01055  Biosynthesis of vancomycin group antibiotics
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01250  Biosynthesis of nucleotide sugars
Module
sma_M00799  dTDP-L-oleandrose biosynthesis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAVERM_949 (aveBV)
   01055 Biosynthesis of vancomycin group antibiotics
    SAVERM_949 (aveBV)
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    SAVERM_949 (aveBV)
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-
     SAVERM_949 (aveBV)
SSDB
Motif
Pfam: dTDP_sugar_isom
Other DBs
NCBI-ProteinID: BAC68659
NITE: SAV0949
UniProt: Q79ZM0
Position
complement(1207922..1208599)
AA seq 225 aa
MTLGRPRRSSADRPAPPAGARATAAGVTVRRLVVEGAVEFTPTVFPDERGLFVTPYQEPV
LSEAVGHRFPTAQTCQSVSRRGVVRGVHFTATPPGQAKYVHCARGRALDFVVDLRTGSPT
FGQWDSVLLDQERFRSVYLPIGVGHAFVALEDDTAMVYLMSSGYVPQNEHALSPEDPDLA
LPLGHHLGRAPILSERDRRAPTLQQALRRGMLPEYRASRGLDEKL
NT seq 678 nt   +upstreamnt  +downstreamnt
atgacccttggccggcctcgccggagctccgccgaccggcccgccccgcccgcgggcgcc
cgggccaccgccgccggtgtcacggtccggaggctcgtcgtcgagggcgccgtcgaattc
accccgacggtcttccccgacgagcgcgggctcttcgtcaccccctaccaggaaccggtc
ctcagcgaggccgtcgggcaccggtttcccaccgcgcagacctgccagagcgtctcgcgc
cgcggcgtcgtccgcggcgtgcacttcaccgcgacaccacccggccaggccaagtacgtc
cactgcgcccggggacgggccctggacttcgtcgtcgacctgcgcaccggctcaccgact
ttcgggcagtgggactcggtcctcctcgaccaggagcgcttccgttccgtctacctgccg
atcggggtcgggcacgcgttcgtggcgctggaagacgacacggcgatggtgtacctgatg
tcgagcggctacgttccgcagaacgaacacgccctctcgcccgaggatccggacctcgcc
ctgcccctcggccaccacctcgggcgggcaccgatcctctccgagcgcgaccggcgcgcg
ccgactctccagcaggccctgcgacgcggcatgttgccggagtaccgcgcgagccgcggc
ctcgacgagaagctgtga

DBGET integrated database retrieval system