KEGG   Streptomyces avermitilis: SAVERM_950
Entry
SAVERM_950        CDS       T00126                                 
Symbol
aveBVI
Name
(GenBank) dTDP-4-keto-6-deoxy-L-hexose2,3-dehydratase
  KO
K16435  dTDP-4-dehydro-6-deoxy-alpha-D-glucopyranose 2,3-dehydratase [EC:4.2.1.159]
Organism
sma  Streptomyces avermitilis
Pathway
sma00523  Polyketide sugar unit biosynthesis
sma01055  Biosynthesis of vancomycin group antibiotics
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01250  Biosynthesis of nucleotide sugars
Module
sma_M00799  dTDP-L-oleandrose biosynthesis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAVERM_950 (aveBVI)
   01055 Biosynthesis of vancomycin group antibiotics
    SAVERM_950 (aveBVI)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.159  dTDP-4-dehydro-6-deoxy-alpha-D-glucopyranose 2,3-dehydratase
     SAVERM_950 (aveBVI)
SSDB
Motif
Pfam: Hexose_dehydrat
Other DBs
NCBI-ProteinID: BAC68660
NITE: SAV0950
UniProt: Q79ZL9
Position
complement(1208661..1210070)
AA seq 469 aa
MSVRADADHTEPSTAHRAARRRPARVPRPLRRRGRHRRRTSLDAFTGWWTRRSGAHRFRV
ERIPFHGMDAWSFHPGTGNLAHRSGRFFSVEGLHVRGGEQPFPEWQQPIIHQPEIGILGI
LAKKFDGVLHFLMQAKMEPGNINLVQLSPTVQATRSNYTKVHGGAAVKYLEYFTQPRRAT
VVVDVLQSEHGAWFHRKFNRNIVVETDEDVPLDDDFRWLTLGQIGELMHRDNLVNMDART
VLACLPTPFDEPAALHSDAELLSWYAAERSRHSVHARRVPLAGIPGWTTGAESIAHHADR
YFRVVAVRVEASNREVAAWTQPLIEPCGHGITAFLTRRIGGVPHLLAHGRVEGGFLDTIE
LGPTVQYTPRNYAHLTGPARPRFLDLVLEAAPDRIRYAAVHSEEGGRFLHAQARYLFVEA
DESQAPNDPPPGYRWCTPGQLTQLLRYGRYVNVQARTLLSLLTTRAVEL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgagcgtacgagccgatgccgaccacaccgagcccagcaccgctcaccgcgcggcacga
cgccgccctgcccgcgtgcctcgcccgctccgccgccgtgggcgacaccggcgccggacg
tccctcgacgcgttcaccggctggtggacgcggcggtccggggcccaccggttccgggtc
gagcgcatccccttccacgggatggacgcctggtcgtttcaccccggaaccggcaatctg
gcccaccgcagcggccggttcttctccgtggagggactgcacgtccgaggcggtgaacag
cccttcccggaatggcagcagcccatcatccaccagcccgagatcggcatcctcggcatc
ctcgccaagaagttcgacggggtcctgcacttcctgatgcaggccaagatggagcccggc
aacatcaacctggtccagctgtcgcccaccgtgcaggccacgcgcagcaactacaccaag
gtccacgggggcgccgccgtgaagtacctcgagtacttcacacagccccggcgcgccacc
gtggtggtcgacgtcctccagtccgagcacggagcctggttccaccggaagttcaaccgc
aacatcgtggtggagaccgacgaggacgtaccactggacgacgacttccgctggctgaca
ctggggcagatcggcgaactgatgcaccgggacaacctggtgaacatggacgcacgcacg
gtcctcgcctgccttcccaccccgttcgacgagcccgcggccctgcacagcgacgccgaa
ctgctctcctggtacgccgccgaacgctcccggcactccgtgcacgcccgccgcgtgccc
ctggccggcatccccggctggaccacgggcgcggagtccatcgcccaccacgcggaccgg
tacttccgtgtggtcgcggtccgtgtcgaggcctccaaccgggaggtcgccgcctggacc
cagcccctgatcgaaccgtgcggccacggcatcaccgccttcctgacccggcggatcggc
ggcgtaccgcacctgctcgcccacggcagggtcgagggcggcttcctcgacacgatcgaa
ctcggcccgacggtccagtacaccccgcgcaactacgcccacctcacgggaccggccagg
ccgcgcttcctcgacctggtgctggaggccgcgcccgaccgcatccgctacgcggcggtc
cactcggaggagggcggtcgctttctgcacgcacaggcgcgctacctgttcgtcgaggcc
gacgagagccaggcgccgaacgacccgcccccggggtaccgctggtgcaccccgggccag
ctgacccagctgctgcggtacggccgttacgtgaacgtgcaggcccgcaccctgctgtcc
ctgctcaccacccgcgccgtcgagctgtga

DBGET integrated database retrieval system