KEGG   Streptomyces malaysiensis: SMALA_8314
Entry
SMALA_8314        CDS       T05189                                 

Name
(GenBank) chorismatase
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMALA_8314
Enzymes [BR:smal01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     SMALA_8314
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: ATL88523
UniProt: A0A291T5T8
Position
complement(10401754..10402809)
AA seq 351 aa
MARTYFAVLVRTPGPRRRSRRSATPHCSFEKIASPDLADDETVLGVIEHRTGHSGVALID
GRPHTAVHTTTDESESFAEVWRVDGPKESGSHGGIAWARTADYLFGVARVPEGDRYADGT
AAVYTGIFDLIGELGHPRLARTWNYVSGINTLNADGMEVYRDFCVGRAEALDARGVEPAG
MPAATGIGTHGGGIACYFLAARAGERVNLENPAVLTAHRYPRQYGPRPPIFARATWLAPP
GSDDGRLYVSATAGIRGHETVHHGDVARQCDVALENIAQVISAENLRRHGLRRGYTLADV
DHLKVYVRHREDVRAVRRICAERFSREATVAVLHTDIARTDLLVEIEGVVA
NT seq 1056 nt   +upstreamnt  +downstreamnt
gtggcgcgcacatatttcgctgtgctggtgcgtaccccaggaccgcgaaggcggtcgaga
cgatcagccacgccgcactgctccttcgagaagatcgcgtcgcccgacctcgccgacgac
gagacggtgctcggcgtcatcgaacaccgcaccgggcacagcggggtggccctgatcgac
ggccgcccgcacaccgcggtgcacacgaccaccgacgagagcgagtcgttcgccgaggtg
tggcgggtggacggtccgaaggagtcgggcagccacggcggcatcgcctgggcccggacg
gccgactatctcttcggcgtcgcccgggttccggagggagaccgctacgcggacggcacc
gcggccgtctacaccgggatcttcgacctgatcggcgagctgggacacccccggctggcc
cggacctggaactacgtcagcggcatcaacacgctgaacgccgacggcatggaggtctac
cgcgacttctgtgtgggccgcgccgaagcgctggacgcccgcggggtcgaaccggccggc
atgccggcggcaaccggcatcggcacccacggcggcggcatcgcctgctacttcctcgcc
gcccgcgccggtgagcgggtcaacctggagaaccccgccgtgctgacggctcatcgctac
ccacggcagtacggcccccgcccgccgatcttcgcccgcgccacctggctcgcgccgccc
ggatcggacgacggccggctctacgtctcggcgaccgccggcatccgcggccacgagacc
gtgcaccacggggacgtcgcccggcagtgcgacgtggcgctggagaacatcgcccaggtg
atcagtgccgagaacctacggcggcacgggcttcggcgggggtacacgctggccgacgtc
gaccacctgaaggtctacgtacgacaccgcgaggacgttcgggccgtacgccggatctgc
gccgagcggttttcccgcgaggccacagtggccgtgctgcacaccgacatcgcacgcacc
gacctcctggtcgagatcgagggagtggtggcgtga

DBGET integrated database retrieval system