KEGG   Sinorhizobium meliloti 1021: SMc00611
Entry
SMc00611          CDS       T00058                                 
Name
(GenBank) Hypothetical transmembrane protein
  KO
K14205  phosphatidylglycerol lysyltransferase [EC:2.3.2.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme01503  Cationic antimicrobial peptide (CAMP) resistance
sme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMc00611
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SMc00611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sme01504]
    SMc00611
Enzymes [BR:sme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.3  lysyltransferase
     SMc00611
Antimicrobial resistance genes [BR:sme01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF [MD:M00726]
    SMc00611
SSDB
Motif
Pfam: LPG_synthase_C LPG_synthase_TM Acetyltransf_6
Other DBs
NCBI-ProteinID: CAC45759
RhizoBase: SMc00611
UniProt: Q92KG2
Position
1282231..1284774
AA seq 847 aa
MASSTEEFEAEDQQDRGAWRLFLRRNQRYLSAIGTLLVIALFGAAIFHLTAEVRYDDVVS
ALADTSRRSVATAILFTGLSFLALTFYDVSALDYIERKLPYPAVALTAACAYAVGNTAGF
GPLSGGAIRYRSYSRLGLKPEEIARLIAFVTLAFGLGLAVVTCLSLLAVGEYVAPLTGID
AAWLRAIAVFVLAGLLVVLIAARSGREVRIGRLVLRLPDSQTCSRQFLVTALDLAASATV
LYVLLPAGTVGWPAFLAIYAVAVGLGVLSHVPAGLGVFEAVIVASLGRAAGVDAVLGALV
LYRVIYHLLPLLIAIVVMIGIELRQLAGHPAASSLRRAGGRMTPLLLATLALVLALMLVL
SGVTPTPDENLAFLANYVPLPIIEGAHFLASLLGLALFIVARGLALRLDGAWWASVAIAL
AAILLSLVKAVALGEAGMLAFLLVGLLASRRLFNRPASLFGQALTLPWLTALGVICFGAF
VVLLFVYRDVAYSHELWWQFEFSAEAPRGLRAFLGVTIGASAVAIWSLMRPAAAAVAPAC
GQEMERAVAVVDAQDMSDANLVRMGDKSIMFSADGRAFIMYGRWARSWIALFDPVGPVDA
WPDLIWQFIEAARSNGCRAVFYQVSARGLSHYADAGLRAFRLGELAEVDLTRLEMKGGKW
ANLRQQVSRGIRDGLEFSVVAPPEIPAILPELGAVSDAWLAHHNAREKGFSLGAFDPRYL
TAQPVAILKRQGRIVAFANILITGTKEEGSVDLMRFSPDAPKGAMDFLFAQLMEYLKNEG
YRRFNLGMAPLSGMSERRLAPVWDRAGRAFYEHGERFYNFKGLRAFKSKFHPQWQPRYLV
ASTRSWR
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggcttcctccacggaagagtttgaagcggaagaccaacaggaccgcggtgcatggcgg
ctctttctgagacgcaaccagcgttacctctccgcgataggcacactcctcgtgatcgcg
ctcttcggcgcggcgatctttcacctgacggccgaggtgcgatatgacgacgtcgtgtcg
gcgctggcggatacgagccggcgatcggtggcaacggcgatcctgttcacgggcctgagc
ttcctcgcactcaccttctacgacgtcagcgcgctcgattacatcgaacgcaagcttccc
tatcccgccgtcgcgctcacggccgcctgcgcctatgccgtcggcaacacggcgggcttc
ggtccgctgagcggcggtgcaatccgctatcggtcctattcgcgcctcgggctgaagccg
gaggagatcgcccgtctcattgccttcgtcacactcgccttcgggttgggtctcgcggtg
gtcacctgcttgagcctgcttgccgttggcgaatacgtggcgccgctgaccgggatcgat
gcggcatggctgcgggcaatcgccgtcttcgtccttgccggtttgctggtggtgctgatc
gccgctcgcagcggtcgcgaggtccgcatcggccgcctcgtcttgcgtctgccggactca
caaacatgttcgcgccagttcctcgtcacggcgctcgatctcgcggcgtcggcgaccgtc
ctctatgtccttttgcccgccggaacggtgggctggccggccttcctggcgatctatgcc
gtggcggtcggcctcggcgtgctcagccatgtgccggcggggctcggcgttttcgaagcg
gtgatcgttgcgagcctgggccgcgcagccggcgtcgatgcggtgctcggtgcactcgtc
ctctaccgcgtcatctaccacctgttgcccttgctcatcgccatcgtcgtgatgatcggc
atcgaactccgccagctggcgggccacccggcagcctccagccttcgccgcgccggcggc
cggatgacgccgctattgcttgccacgctggcgctcgtcctcgccctgatgctggttctc
tcgggcgtgacgccgacgccggacgagaacctggcctttcttgcgaattacgtgccccta
ccgatcatcgaaggcgcgcatttccttgcgagccttttgggtctggcgctgttcatcgtc
gcgcgggggctggcgctgcgcctcgatggcgcctggtgggcatcggtcgcgatcgcgttg
gccgcaatcctgctttcgttggtgaaggcggtggcgctcggggaagccggcatgctcgcc
ttccttcttgtcgggcttctcgcaagtcggcggctcttcaatcgtcccgcctcgcttttc
ggacaggcgctgacgctgccgtggcttaccgcgctcggcgtcatctgtttcggcgcattc
gtcgtcctgctctttgtctatcgcgacgtcgcatacagccatgagctctggtggcagttc
gaattctcggcggaagcgccgcgcgggctccgcgccttcctgggagtgacgatcggcgca
agtgctgtagcgatctggagcctgatgcgcccggccgctgcggccgttgcccccgcctgc
ggacaggagatggagcgggcggtcgccgtcgtcgacgcgcaggacatgtccgacgccaac
ctcgtgcgcatgggtgacaagagcatcatgttctccgccgacggccgggccttcatcatg
tatggccgctgggcgcgttcctggattgcgttgttcgatccggtcggacccgtggatgcc
tggccggatctcatctggcagttcatcgaggcggcgcgctccaatggttgccgcgccgtc
ttctaccaggtctcggcgcgcgggctttcgcattacgcggatgcgggcttgagagccttc
cgcctcggcgaacttgccgaggtcgatctcacgcgcctcgagatgaagggcggcaagtgg
gcaaacctgcgccagcaggtgagccgtggcattcgcgacgggctggagttctcggtcgtc
gcgcccccggaaataccggcgatccttccggagctcggggccgtttccgatgcttggctc
gcccaccacaatgcgcgggagaagggcttttccctcggcgccttcgatccgcgatacctg
acggcgcagcctgtcgcgatcctcaaacggcagggtcgcatcgtggccttcgccaatatt
ctgatcaccggcaccaaggaggagggctcggtcgacctcatgcgtttctcgcccgacgcg
ccgaaaggggcgatggatttcctgttcgcgcaactgatggaatatctgaagaacgagggc
tatcggcgtttcaatctcggaatggcgccgctgtcgggcatgtcggagcgccggctggcg
cccgtatgggaccgcgccggccgggcattctacgagcacggcgagcgcttctacaacttc
aagggactgcgcgccttcaagtccaagtttcacccgcagtggcagccgcgctatctggtg
gcttcaacccgatcctggcgctga

DBGET integrated database retrieval system