KEGG   Sinorhizobium meliloti 1021: SMc01438
Entry
SMc01438          CDS       T00058                                 
Symbol
degP2
Name
(GenBank) Probable serine protease
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme01503  Cationic antimicrobial peptide (CAMP) resistance
sme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMc01438 (degP2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SMc01438 (degP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sme01002]
    SMc01438 (degP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sme03110]
    SMc01438 (degP2)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     SMc01438 (degP2)
Peptidases and inhibitors [BR:sme01002]
 Serine peptidases
  Family S1: chymotrypsin family
   SMc01438 (degP2)
Chaperones and folding catalysts [BR:sme03110]
 Other chaperones and cochaperones
  DegP / HtrA
   SMc01438 (degP2)
SSDB
Motif
Pfam: Trypsin_2 PDZ_2 Trypsin PDZ Peptidase_M50 PDZ_6 Peptidase_S29 Peptidase_S46
Other DBs
NCBI-ProteinID: CAC46700
RhizoBase: SMc01438
UniProt: Q926C8
Position
complement(2282383..2283894)
AA seq 503 aa
MSKRPEFFRGLVLAAATALIFTNATLAQTATSRPPAGPPSVADLAEGLLDAVVNISISQN
VKSDDDNAPMPQVPEGSPHQEFFDEFFRGQGGEGGRPRTVNSLGSGFIIDPAGYIVTNNH
VIQDADDIEINFSDGSKLKAKLVGMDTKTDLALLKVEPKKPLKAVSFGDSRKIRIGDWVM
VVGNPFGLGVSVSVGVVSARGRNINAGPYDSFIQTDAAINRGNSGGPLFNMQGEVVGINT
AILSQTGMSVGIGFAVPAELAVNVVNQLKEFGETRRGWLGVRIQPVTDDIAESLKMELPR
GALVSGIIEGGPITKGEIKPGDIIIRFDGTDIAEIRDLMRTVGESPVGKAVDVVIIRDGK
EQTVRVTLGRLEDGEQLANAKPGEVLPNGGEAKPGEPPAAQLPASDTVLGMKLAELDADS
RQSFGIAESVKGVVITEVQPNSPAAERRVEPGEVIVELGQEAMETPEDVTSRVTELKADG
RRNALLMIANKSGELRFVTVRME
NT seq 1512 nt   +upstreamnt  +downstreamnt
ttgtcgaaacgacccgaattcttccgcggcctggtgctggcggccgcgacggcactcata
ttcaccaatgcgacgctggcccagacggccacgtcccggcctccggccggcccgccgtcc
gtcgccgatctcgccgagggactgctcgacgccgtcgtcaacatatcgatttcgcagaac
gtcaagagcgacgacgacaatgcgccgatgccgcaggtgccggaaggatcgccgcatcag
gagttcttcgacgagtttttcaggggacagggcggcgagggcggccggccgcgcacggtc
aactcgctcggttcgggcttcatcatcgatccggccggctacatagtcaccaacaaccac
gtcattcaggatgccgacgatatcgagatcaacttctccgatggatcgaaactgaaggcg
aagcttgtcggcatggatacgaaaaccgacctcgccctcctgaaggtcgaaccgaagaag
ccgctcaaggccgtctccttcggcgactcgcgaaagatcaggatcggcgattgggtgatg
gtcgtcggcaatccgttcggccttggcgtatccgtgtccgtgggtgtcgtctccgcacgc
ggtcgcaatatcaatgccggaccctacgacagtttcatccagaccgacgcggcgatcaac
cgcggcaattcgggcggtccgctcttcaacatgcagggtgaggtcgtcggcatcaatacg
gcgatcctttcgcagaccggcatgtcggtcggtatcggctttgccgtgccggcggagctt
gcggtgaacgtcgtcaatcaactcaaggaattcggcgaaacccgccgtggctggctcggt
gtacggatccagcccgtcacggacgatatcgccgagagcctgaagatggagctgccacgc
ggcgcgctcgtttcgggcatcatcgaaggcggtccgatcaccaagggcgagatcaagccg
ggcgacatcatcatccgcttcgacggaacggatatcgcggaaatccgcgacctcatgcgc
actgtcggcgagagcccggtcggcaaggcggtcgatgtggtcatcatccgcgacggcaag
gaacagaccgttcgcgtgacgctcggtcggctggaggacggcgagcagctcgccaatgcg
aaaccgggggaagtgctgccgaatggcggtgaggcgaagcccggcgagccgccggccgcg
caactgcctgcgagtgacacggtgctcggaatgaagcttgccgagctcgacgccgacagt
cgccagagtttcggcatcgccgaaagcgtcaaaggcgtcgtgatcaccgaggtacagccc
aattcgcccgcggccgagcgtcgggtagagccgggcgaggtgatcgtcgaactcggtcag
gaagcaatggaaacgccggaggatgtcacctcacgcgtcaccgaactgaaggccgacggg
cgccgcaacgccttgctgatgatcgcgaacaagagcggcgaactgcgcttcgtgacggtg
cggatggaatag

KEGG   Sinorhizobium meliloti 1021: SMc02365
Entry
SMc02365          CDS       T00058                                 
Symbol
degP1
Name
(GenBank) Probable serine protease
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme01503  Cationic antimicrobial peptide (CAMP) resistance
sme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMc02365 (degP1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SMc02365 (degP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sme01002]
    SMc02365 (degP1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sme03110]
    SMc02365 (degP1)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     SMc02365 (degP1)
Peptidases and inhibitors [BR:sme01002]
 Serine peptidases
  Family S1: chymotrypsin family
   SMc02365 (degP1)
Chaperones and folding catalysts [BR:sme03110]
 Other chaperones and cochaperones
  DegP / HtrA
   SMc02365 (degP1)
SSDB
Motif
Pfam: Trypsin_2 PDZ_2 PDZ_6 PDZ Peptidase_M50 Trypsin PDZ_1 Tricorn_PDZ DUF3394 Peptidase_S46 Peptidase_S29 COA2 DUF6288
Other DBs
NCBI-ProteinID: CAC45593
RhizoBase: SMc02365
UniProt: Q52894
Position
1112257..1113771
AA seq 504 aa
MLKTTTVAGLAAVLLTTGLPAEVAQSFAEAVRVQAPAVPSFANVVDAVSPAVVSVRVQAR
ERVSDDESNFTFDFGGRGFEDLPEDHPLRRFFREFAPRENDRADRWRDRRGPRGEGRLRP
RAQGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTELDAKLVGKDSRTDLAVLKVDDKR
KFTYVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSGPYDDYLQVDAAVN
RGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDSLIKDGTVSRGWLG
VQIQPVTKDIAESLGLSEANGALVVEPQAGSPGEKAGIKNGDVVTALNGEPVKDPRDLAR
RVAALRPGSTAEVTLWRSGKSETVNLEIGTLPSDAKEPAPATGEAQPDEGQAGEEALADL
GLTVTPSEDGKGVTIASVDPDSDAGDRGLKEGEKIVSVNNQEVKSADDVLKVINNAKKDG
RSKALFQIEAQEGSRFVALPITQG
NT seq 1515 nt   +upstreamnt  +downstreamnt
gtgctgaagaccacgacggtagccggtctcgcagccgtgctgctgacgaccggcctgccg
gccgaagtcgcgcagtccttcgccgaagccgtgagggtgcaggccccggctgtgccgagt
ttcgccaatgtggtcgacgccgtttcgccggcggtcgtctccgtccgcgtgcaggcacgt
gaacgcgtcagcgacgatgaaagcaacttcaccttcgatttcggcggccgcgggttcgag
gacctgccggaagaccatccgctgcggcgtttcttccgcgaattcgctccgcgtgaaaat
gaccgtgccgatcgttggcgcgaccgccgcggtccgcgtggcgaaggtcgtctccgtccg
cgggcgcaaggctccggcttcttcatcaccgaagacggttacctcgtcaccaacaaccac
gtcgtctccgacggctcggccttcaccgttatcatgaacgacggaaccgagctcgacgcc
aagctcgtcggcaaggacagccggaccgaccttgccgtgctcaaggtcgatgacaagcgc
aagttcacctatgtcagcttcgcggacgacgagaaggtgcgcgtcggcgactgggtggtc
gctgtcggcaatcccttcggcctcggcggcacggtcactgccggcatcatctccgctcgg
ggccgcgatatcggctccggtccctatgacgattatctgcaggtcgacgcagcggtgaac
cgcggcaattccggtggtccgaccttcaatctttccggcgaggtggtcggtatcaacacg
gccatcttttcgccctccggcggcaatgtcggtatcgcctttgcaatccccgcctcggtc
gcgaaggatgtcgtggactccctcatcaaggacggcacggtgtcgcgcggctggcttggt
gtccagatccagccggtgacgaaggatatcgccgagtcgctcggcctttccgaagcgaac
ggcgccctcgtcgtcgagcctcaggcgggctcgccgggtgaaaaggccgggatcaagaac
ggcgacgtcgtgacggcactcaacggcgagccggtcaaggatccgcgggacctcgcacgt
cgcgttgcggccctgcgccccggctccactgcagaggttaccctgtggcgcagcggcaaa
tccgaaacggtcaacctcgagatcggcacgctgccgagcgatgccaaggaacccgcaccg
gcgaccggtgaagcgcagcccgacgaagggcaggcaggcgaggaggcgctggccgacctc
ggcctgacggtgaccccgtcggaggacggcaagggcgtcacgatcgcctccgtcgatccg
gattcggacgccggcgatcgcggcctgaaggaaggcgagaagatcgtctccgtcaacaat
caggaagtgaaatcggcagacgacgttctcaaggtgatcaacaacgccaagaaggacggg
cgcagcaaggctctgttccagatcgaagcacaggaaggcagccgcttcgtcgcactgccc
atcactcagggctga

DBGET integrated database retrieval system