KEGG   Streptomyces mobaraensis: J7W19_26975
Entry
J7W19_26975       CDS       T07674                                 
Name
(GenBank) FAD-dependent monooxygenase
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Organism
smob  Streptomyces mobaraensis
Pathway
smob00404  Staurosporine biosynthesis
smob01100  Metabolic pathways
smob01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smob00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    J7W19_26975
Enzymes [BR:smob01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-
     J7W19_26975
SSDB
Motif
Pfam: FAD_binding_3 DAO FAD_binding_2 NAD_binding_8 Lycopene_cycl Pyr_redox_2 HPIP Pyr_redox_3 HI0933_like Pyr_redox Thi4
Other DBs
NCBI-ProteinID: QTT76534
UniProt: M3B4D5
Position
complement(6231431..6233059)
AA seq 542 aa
MTTTHADGEGSGGRSAPFDTDVLIVGAGPVGLALALDLRHRGVRFRLLDASDGRVEHPKV
GTVGPRSMELFRRWGLAHAIRTAGWPGDHPLDVAWVTAVGGHEIHRLAFGTSDSRPPLPW
TPEPEQVCPQHLLLPLLARAVGVHPDGPLRHGRRLDGLVQDATGVTASVTRLADGTRRTV
RARWLVGCDGATSTVRRLLGVDAPSRHPVRIFRNILFRAPELDARLGDRRALVYFLTRPP
DLRYPLRSMDGHGLYRLTATAETARHQDPMALLRSAVAVDTPLEVVSEHVWHLTHRIADR
YRVGRVLLAGDAAHTLPPAGGFGMNTGIGDAADLGWKLAAELAGWAGPGLLDAYATERRP
VAERGLAAAGANLRRTVDRTLPQEILLDTPEGDRARAALARRLGSEAVHTEFDAPDLHFG
HRYASPLIVTDPDGDDGDWRSGALPGARAPHAWLSGGTSTLDLFGTGFRLLCFADAPPPD
ALTDAFARRSVPLAVTHCHDRLVARLYGRPYVLVRPDGHVAWRADGPPLDPGLLVDTVRG
AR
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgacgaccacgcatgccgacggggaagggagcgggggccggagcgcgcccttcgacacc
gacgtcctgatcgtcggcgccggcccggtcgggctggcgctggccctggacctgcgacac
cggggcgtccgcttccggctcctggacgcctccgacgggcgggtggagcaccccaaggtc
ggtacggtcgggccgcgttcgatggagctgttccggcgctggggcctcgcgcacgccatc
cggacggccggctggcccggcgaccacccgctggacgtggcgtgggtgaccgcggtcggc
ggccacgagatccaccgcctggcgttcggcacctccgacagccggccgccgctcccctgg
acgccggaaccggagcaggtctgtccgcagcacctgctactgccgctgctcgcccgcgcg
gtcggcgtccatcccgacggaccgctgcggcacggccggcgcctcgacggcctcgtccag
gacgccaccggcgtcaccgcctccgtcacccgcctcgccgacggcacccgccgcaccgtg
cgggcccgttggctggtcggctgcgacggcgccacgtcgaccgtccgccggctcctcggt
gtcgacgcaccctcccgccaccccgtccgcatcttccgcaacatcctcttccgcgcgccg
gaactcgacgcacggctcggtgaccgccgggccctcgtctacttcctcacccgacccccg
gacctgcgctatccgttgcggtcgatggacggccacgggctgtaccggctgaccgccacc
gccgagacggcgcggcaccaggatccgatggcgctgctgcggtccgccgtcgccgtggac
accccgctggaggtggtgtccgagcacgtgtggcacctgacccaccggatcgccgaccgc
taccgcgtcggccgcgtgctgctcgccggggacgcggcgcacaccctcccgccggcgggc
ggtttcggcatgaacaccggcatcggcgacgccgccgacctcggctggaagctcgccgcc
gagctggccggctgggcggggccgggactgctcgacgcgtacgcgaccgaacgccgtccg
gtcgcggagcgcggtctggcggcggccggagccaacctgcggcgcacggtcgaccgcacg
ctcccccaggagatcctgctggacaccccagagggcgaccgggcccgtgcggcactggcc
cggcggctgggcagcgaggccgtccacaccgaattcgacgcccccgacctgcacttcggc
caccgctacgcctccccgctgatcgtcaccgatccggacggcgacgacggggactggcgc
tccggcgccctgcccggcgcccgcgccccgcacgcctggctcagcggcggaacgtcgacg
ctcgacctcttcggcaccggcttccgcctgctgtgcttcgcggacgccccaccgccggac
gccctcaccgacgccttcgcccgccggagcgtgccactcgcggtcacccactgccacgac
cggctggtggcgcggctgtacggcaggccgtacgtcctggtgcgcccggacggccacgtg
gcctggcgcgccgacggcccaccgctggacccggggctgctggtggacaccgtacggggg
gcacggtga

DBGET integrated database retrieval system