KEGG   Starkeya novella: Snov_1008
Entry
Snov_1008         CDS       T01258                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K24299  thiocyanate desulfurase [EC:1.8.2.7]
Organism
sno  Starkeya novella
Brite
KEGG Orthology (KO) [BR:sno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Snov_1008
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.2  With a cytochrome as acceptor
    1.8.2.7  thiocyanate desulfurase
     Snov_1008
Other DBs
NCBI-ProteinID: ADH88330
UniProt: D7A6V6
Position
complement(1045094..1046938)
AA seq 614 aa
MDELGKTGRDEEAQHRADVAAQPEPSPRAQIDAYLSRRNEVARSDHEEFQDYLREKQARA
LAARQILPPPMPADEAPTDEATSTRFTRRNIFKAAAATAIVGETAAFAYGSGALNALGVT
GGDGSAQAGASVVAQAQSAPIARELIDSRSSFDGQGLGKWVALLPTKMGGGTYALDLNTN
RVLASIWYWNYGDFNPISHHLCAFPSADPYHSFEFVNSTQGGKNSLIYGIPTNITEPGPG
FNIYRVRYDGAQMQLMENVSETTGLGLGVHVCVNPKDAQSYFVTDGQKDIAACFDRTTSQ
VKAALKFDWKANSTRLDRAWQDGGVLKISKIYPDAATGKYDYLGTKGQKIDWEMVPMGEL
FVEEGTLPGDDPMGLTGADGTIWHPTGRWAATVVRLCGGIAILDAENGFEPVAFLQFNVD
SPDQYEVVKLDQDHWEVTFDKIHSPGHEIGFSPDGRFLCMMNNLRENNCSVFSCEDPDPR
NWKKIAHVEDPLWKGKYPNPFHMVFSLDSKKLYLSVLHPSPAASGVMVVDTDTWTIRKEI
QGIGPDLQTPAITYDGKFVVVPFSGFQRLSSGIAIIDAATDNLIGILPSTGGHHDCVIIP
TELEHMKHTRSCTL
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggatgagctaggcaagactgggcgggacgaggaagcgcagcaccgtgcggatgtggcc
gcgcagccggaaccgtcgccgcgcgcgcagatcgatgcctatctcagccgccgcaacgag
gtagcgcgttcggaccacgaggagttccaggactatctccgcgagaagcaggcccgggcg
cttgcggcgcgccagatattgccgccgccaatgcccgcggacgaggcgccgacggacgag
gcgacgtccacccgtttcacccgccgcaacatcttcaaggctgcggccgcgacggcgatc
gtcggcgagaccgctgcgttcgcctatggttccggcgcgctgaacgcgctcggtgtgacg
ggcggcgacgggagcgctcaagccggcgcctcggtcgtcgcgcaggcgcagagcgcgccg
atcgcccgcgagctcatcgactcccgctcgagtttcgacggccagggcctcggcaagtgg
gtagccctgctgccgaccaagatgggcggcggcacctatgcgctcgacctcaacaccaac
cgcgtgctcgcctcgatctggtactggaactacggggacttcaacccgatctcccaccat
ctctgcgcctttccgagcgccgacccgtatcacagcttcgagttcgtcaactcgacgcag
ggcggcaagaactcgctgatctacggtatccccaccaacatcaccgagccgggcccgggc
ttcaatatctaccgcgtgcgctatgacggcgcgcagatgcagctgatggagaacgtgtcg
gagaccacaggcctcggtctcggcgtgcatgtctgcgtcaacccgaaggacgcgcagtcc
tatttcgtgaccgacgggcagaaggacatcgccgcctgcttcgaccgcaccacctcgcag
gtgaaggcggcgctcaaattcgactggaaggcgaattcgacccgcctcgatcgggcgtgg
caggacggcggggtgctgaagatctcgaagatctatcccgatgccgccaccggcaagtac
gattatctcggcaccaagggccagaagatcgactgggagatggtgcccatgggcgagctc
ttcgtcgaggaaggcaccttgcccggcgacgatccgatgggcctcaccggcgccgacggc
accatctggcatccgaccggacgctgggccgcgaccgtcgtgcggctgtgcggcggcatc
gccattctcgatgcggagaacggcttcgagccggtcgccttcctgcagttcaacgtggac
tcgcccgaccagtacgaagtggtgaagctcgaccaagaccattgggaggtcacgttcgac
aagatccactcgcccggtcatgagatcggcttttcgccggatggccggttcctctgcatg
atgaacaatctgcgcgagaataattgctcggtcttctcctgcgaggatcccgatccgcgc
aactggaagaagatcgcccatgtcgaggatccgctgtggaaggggaaataccccaatccg
ttccacatggtgttctcgctggattcgaagaagctctacctttccgtgctccatccctcg
ccggcggcgagcggcgtgatggtggtcgacaccgacacctggaccatccgcaaggagatc
cagggcatcggcccggacctgcagacgccggccatcacctatgacggcaagttcgtcgtg
gtgccgttcagcggcttccagcggctgtcgagcgggatcgccatcatcgacgccgcgacc
gacaatctgatcggcatcctgccgagcaccggcggccaccatgactgcgtgatcattccc
accgagctcgagcacatgaagcacacgcgttcctgcacgctctga

DBGET integrated database retrieval system