Streptomyces nodosus: CP978_14990 Help Entry CP978_14990       CDS       T06839                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism snq  Streptomyces nodosus Brite KEGG Orthology (KO) [BR:snq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:snq03400]     CP978_14990 Enzymes [BR:snq01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      CP978_14990 DNA repair and recombination proteins [BR:snq03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     CP978_14990  Prokaryotic type     CP978_14990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Nudt16-like Sa_NUDIX UBM Motif Other DBs NCBI-ProteinID:  QEV39688 UniProt:  A0A0B5DD23 Position 3332532..3332939 Genome browser AA seq 135 aa AA seqDB search MSVAGVIVDDQGRALLIKRRDNGHWEPPGGVLEREETIPEALQREVLEETGIKIELPAAL TGVYKNMTGLIVSLVFRCRAADGTPTTGDETRALRWATREEVIELADEAYAIRVLDALDA ASPPATRAHDGVKLV NT seq 408 nt NT seq  +upstreamnt  +downstreamnt gtgagcgtcgccggggtcatcgtcgatgaccaaggccgggccctcctgatcaagcgtcgc gacaacggtcactgggaacccccgggcggggtcctcgaacgtgaggagaccatccccgaa gccctccagcgtgaagtcctcgaagagaccggcatcaagatcgagcttcccgcggccctg accggcgtctacaagaacatgacgggcctgatcgtctccctcgtcttccgctgccgggcg gccgacggtactcccaccacgggggacgagacccgtgcactgcgctgggccacccgcgaa gaagtcatcgaacttgccgacgaggcgtacgcgatccgcgtccttgacgcactcgacgcg gcgtccccgccggccacccgcgcccacgacggcgtgaaactcgtctag

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (5) Pfam (5) All databases (7) Download RDF

DBGET integrated database retrieval system