Serratia odorifera: NCTC11214_00552 Help Entry NCTC11214_00552   CDS       T06612                                  Symbol gmhA_2 Name (GenBank) Phosphoheptose isomerase   KO K03271   D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28] Organism sof  Serratia odorifera Pathway sof00541   Biosynthesis of various nucleotide sugars sof01100   Metabolic pathways sof01250   Biosynthesis of nucleotide sugars Module sof_M00064   ADP-LDmanHep biosynthesis, sedoheptulose-7P => ADP-LDmanHep Brite KEGG Orthology (KO) [BR:sof00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00541 Biosynthesis of various nucleotide sugars     NCTC11214_00552 (gmhA_2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01005 Lipopolysaccharide biosynthesis proteins [BR:sof01005]     NCTC11214_00552 (gmhA_2) Enzymes [BR:sof01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.28  D-sedoheptulose-7-phosphate isomerase      NCTC11214_00552 (gmhA_2) Lipopolysaccharide biosynthesis proteins [BR:sof01005]  Core region   NCTC11214_00552 (gmhA_2) SSDB OrthologParalogGFIT Motif Pfam:  SIS_2 DUF8572 Motif Other DBs NCBI-ProteinID:  VDZ52145 Position 1:complement(486308..486601) Genome browser AA seq 97 aa AA seqDB search MYHDLIRNELNEAADTLAKFINDDANIDAIQRAAVLLADAFKAGGKVISCGNGGSHCDAM HFAEELTGRYREKPPRLPGDCHFRRQPSVLRQQRFWL NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtaccacgatctgattcgtaatgaactgaacgaagcggcggatacgctggctaaattt atcaatgacgatgccaatatcgatgcgattcaacgcgctgcggtattactggctgatgct ttcaaagcgggcggtaaagtgatttcctgcggcaacggcggttcccactgtgacgcgatg cacttcgccgaagagctgaccggccgctatcgcgaaaaaccgccccggctacccggcgat tgccatttccgacgtcagccatctgtcttgcgtcagcaacgattttggctatga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system