KEGG   Solanum tuberosum (potato): 102588225
Entry
102588225         CDS       T02981                                 

Symbol
CYP74D2, StDES, des
Name
(RefSeq) 9-divinyl ether synthase
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
sot  Solanum tuberosum (potato)
Brite
KEGG Orthology (KO) [BR:sot00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sot00199]
    102588225 (CYP74D2)
Enzymes [BR:sot01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     102588225 (CYP74D2)
Cytochrome P450 [BR:sot00199]
 Cytochrome P450, plant type
  CYP74 family
   102588225 (CYP74D2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102588225
NCBI-ProteinID: NP_001305517
UniProt: Q9AVQ1
Position
Un
AA seq 478 aa
MSSYSELSNLPIREIPGDYGFPIISAIKDRYDYFYNQGEDAWFHNKAEKYKSTVVKINMA
PGPFTSNDYKLVAFLDANSFVCMFDNSLIDKTDTLGGTFKPGKEYYSGYRPVAFIDTKDP
NHAALKGYILSAFAKRHNLFIPLFRNSLSDHLFNNLEKQVTEQGKSDFNALLPTMTFNFI
FRLLCDQTNPSDTVLGAQGPEHLRKWLFPQLIPSLSAKKLPNIIEDTLFHNFLIPFGFIK
SDYNKLVDAFSKSAVSILDEAEKLGIKREEAVQNILFLVGINMFAGLNAFSPHLFRFVGE
AGASLHTQLAKEIRTVIKEEGGAITLSAINKMSLVKSVVYETLRLRPPVPLQYGKAKKDF
MVQSHDASYKINKGQFVVGYQPMASRDPKIFANPDEFVPDRFMNDGEKMLKHVLWSNGRE
TENPAPDNKQCPGKDLVHLLGRLILVEFFMRYDTFTVEITPLFRAPNVAFKTLTKASK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttcttattcagagctatcaaatcttccgattcgtgaaattccaggggactatggt
ttccctataattagcgcgattaaagatcgatacgattatttctataaccaaggtgaagat
gcttggttccataacaaagctgaaaaatacaaatctactgttgtcaaaatcaacatggca
ccaggtccattcacatctaatgactacaaattggtagcatttttagatgccaatagcttt
gtttgcatgtttgataattccctcatcgataaaactgacactcttggtggtacatttaag
cctggtaaagaatactacagtggttatcgtcccgttgcgtttatcgatacgaaagatcca
aaccatgcagcattaaaaggctacattctttcagcgttcgcaaagcgacataacttattc
attcctctattcagaaactcattatctgatcatctttttaataatctcgaaaaacaggtt
actgaacaagggaaatcggatttcaacgccttgcttccaactatgacgtttaatttcatt
tttcgtttgctttgtgatcagactaatccgtctgatacagttcttggcgctcaaggacca
gaacatctacgtaaatggcttttccctcagctaattccgtccttgagcgctaagaaactt
cctaacatcatagaagatacgctcttccataattttttaataccatttggttttataaaa
agtgattacaacaaacttgttgatgcatttagcaagtccgctgtgtccatattggatgaa
gcagaaaaacttggaatcaaaagagaagaagctgtacaaaacattctttttctcgtgggg
atcaatatgtttgcgggcttgaacgctttctcccctcatctcttcaggtttgtgggcgaa
gcaggggctagtctacacacacaacttgctaaagaaatcaggaccgttattaaagaagag
ggtggtgcaatcacattatcagcgattaacaaaatgagtttagtcaagtccgtagtgtat
gagacattgaggcttcgcccaccagtaccattacagtatggtaaggcgaagaaagacttc
atggttcaaagccacgatgcatcttacaagatcaataaagggcaattcgtcgttggatat
cagcctatggctagtagggaccctaagattttcgccaaccctgatgagtttgttcctgat
aggttcatgaatgatggtgagaaaatgctgaaacatgttctatggtctaatggaagggaa
acagaaaatccagcaccagataacaagcaatgtccaggcaaagatttggtgcacctattg
ggtaggttaatattggttgaatttttcatgagatacgatacattcaccgtggaaattaca
cctctatttcgtgcaccaaatgttgccttcaagacgttaaccaaagcaagtaaatag

DBGET integrated database retrieval system