KEGG   Solanum tuberosum (potato): 102601215
Entry
102601215         CDS       T02981                                 

Gene name
nxs
Definition
(RefSeq) neoxanthin synthase, chloroplastic
  KO
K14594  neoxanthin synthase [EC:5.3.99.9]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00906  Carotenoid biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Module
sot_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    102601215 (nxs)
Enzymes [BR:sot01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.9  neoxanthin synthase
     102601215 (nxs)
Motif
Pfam: Lycopene_cycl Pyr_redox_2 FAD_binding_3 Thi4 Trp_halogenase HI0933_like FAD_binding_2 DAO Pyr_redox_3 NAD_binding_9 NAD_binding_8 Pyr_redox GIDA 2-Hacid_dh_C NAD_binding_7 TrkA_N
Other DBs
NCBI-GeneID: 102601215
NCBI-ProteinID: NP_001305601
UniProt: Q9M424
Position
Un
AA seq 498 aa
METLLKPLTSLLLSSPTPHRSIFQQNPPSLNPTTKKKSRKCHFRNESSKLFCSFLDLAPI
SKPESFDVNISLVDPNSGRAQFDVIIIGAGPAGLRLAEHVSKYGIKVCCVDPSPLSMWPN
NYGVWVDEFENLGLEDCLDHKWPMTCVHINDHKTKYLGRPYGRVSRKKLKLRLLNSCVEN
RVKFYKAKVWKVEHEEFESSIVCDDGKKIRGSLVVDASGFASDFIEYDKPRNHGYQIAHG
VLVEVDNHPFDLDKMVLMDWRDSHLGNEPYLRVNNAKEPTFLYAMPFDRNLVFLEETSLV
SRPVLSYMEVKRRMVARLRHLGIKVRSVIEEEKCVIPMGGPLPRIPQNVMAIGGNSGIVH
PSTGYMVARSMALAPVLAEAIVKGLGSTRMIRGSQLYHRVWNGLWPLDRRCIGECYSFGM
ETLLKLDLKGTRRLFDAFFDLDPKYWQGFLSSRLSVKELAILSLCLFGHGSNLTRLDIVT
KCPVPLVRLIGNLAIESL
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggaaacccttctaaagcctttgacatctcttttactttcctctcctacaccacacagg
tctattttccaacaaaatcccccttctctaaatcccaccaccaaaaaaaaatcaagaaaa
tgtcattttagaaacgaaagcagtaaacttttttgtagctttcttgatttagcacccata
tcaaagccagagtcttttgatgttaacatctcattggttgatcctaattcaggtcgggct
caattcgacgtgatcatcatcggagctggccctgctggtctcaggctagctgaacacgtt
tctaaatatggtattaaggtatgttgtgttgacccttcaccactttccatgtggccaaat
aattatggtgtttgggttgatgagtttgagaatttaggattggaagattgtttagatcat
aaatggcctatgacttgtgtacatataaatgatcataaaactaagtatttgggaagacca
tatggtagagtaagtagaaagaagctgaagttgagattgttgaatagttgtgttgaaaac
agagtgaagttttataaagctaaggtttggaaagtggaacatgaagaatttgagtcttca
attgtttgtgatgatggtaagaagataagaggtagtttggttgttgatgcaagtggtttt
gctagtgattttatagagtatgacaagccaagaaaccatggttatcaaattgctcatggg
gttttagtagaagttgataatcatccatttgatttggataaaatggtgcttatggattgg
agggattctcatttaggtaatgagccatatttaagggtgaataatgctaaagaaccaaca
ttcttgtatgcaatgccatttgatagaaatttggttttcttggaggagacttctttggtg
agtcgtcctgtgttatcgtatatggaagtaaaaagaaggatggtagcaagattaaggcat
ttggggatcaaagtgagaagtgttattgaggaagagaaatgtgtgatccctatgggagga
ccacttccgcggattcctcaaaatgttatggctattggtgggaattcggggatagttcat
ccatcgacagggtacatggtggctaggagcatggctttggcaccagtactggctgaagcc
atcgtcaaggggcttggctcaacaagaatgataagagggtctcaactttaccatagagtt
tggaatggtttgtggcctttggatagaagatgtattggagaatgttattcatttgggatg
gagacattgttgaagcttgatttgaaagggactaggagattgtttgatgctttctttgat
cttgatcctaaatactggcaagggttcctttcttcaagattgtctgtcaaagaacttgct
atactcagcttgtgtctttttggacatggctcaaatttgactaggttggatattgttaca
aaatgtcctgttcctttggttagactgattggcaatctagcaatagagagcctttga

DBGET integrated database retrieval system