KEGG   Streptomyces paludis: DVK44_01705
Entry
DVK44_01705       CDS       T06964                                 
Name
(GenBank) FAD-binding monooxygenase
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Organism
spad  Streptomyces paludis
Pathway
spad00404  Staurosporine biosynthesis
spad01100  Metabolic pathways
spad01110  Biosynthesis of secondary metabolites
Module
spad_M00805  Staurosporine biosynthesis, tryptophan => staurosporine
Brite
KEGG Orthology (KO) [BR:spad00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    DVK44_01705
Enzymes [BR:spad01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-
     DVK44_01705
SSDB
Motif
Pfam: FAD_binding_3 DAO FAD_binding_2 Lycopene_cycl Pyr_redox_2 HI0933_like Pyr_redox_3
Other DBs
NCBI-ProteinID: AXG76599
UniProt: A0A345HIS5
Position
complement(400183..401829)
AA seq 548 aa
MTNPVERTDVLIVGGGPVGMALALDLAYRGIGCVVADAGDGTVRHPKVSTIGPRSMELLR
RWGVADAVRDAGWPADHPLDIAWVTRVGGHEIYRYRRGTAAGRPAFAHTPEPDQICPAHW
LNPVLTRAVGVHPDGPLRLRTTVGRVLPADDHVDAVLTDHATGTTGTVRARFLVACDGAA
SPVRRSCGIDAPARHRTQVFRNILFRAPELRKQLGDRAALVHFLMLSSTLRFPLRALNGS
DLYNLVVGVDDSDSDSDTGVVDALSLIRDALALDTPVELLSDGAWHLTHRVADRYRAGRV
LLAGDAAHTLSPSGGFGLNTGVADAADLGWKLAAVLDGWAGRRLLDTYETERRPIAVESL
HEAHLNLQRTLRRRVPPEIHLDGPEGERARAEMARRLESGNVQREFDAPEIHFGLRYRSP
AIIEDPGVPARDGKPDAAWRPGSEPGYRAAHAWWDATTSTLDLFGRGFVLLAFTKGAEHA
AHGQLARIERAFADRGVPFTVREGGDGPVAALYERSYVLVRPDGHVAWRGDELPRDPVEF
VDTVRGDR
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgaccaaccccgttgagcggaccgacgtactgatcgtgggcggcggcccggtcggcatg
gcgcttgcgctggacctggcgtaccggggcatcggctgtgtggtcgccgacgcgggcgac
ggcacggtccggcatcccaaggtcagcacgatcggtccgcgctcgatggaactgctgcgc
cgctggggggtcgcggacgccgtccgcgacgcaggctggcccgccgatcaccccctggac
atcgcctgggtcacccgggtcggcggccacgagatctaccggtaccgccggggaaccgcc
gccggccgcccggccttcgcgcacacccccgagcccgaccagatctgtccggcacactgg
ctgaaccccgtgctgacacgggccgtgggcgttcacccggacggtccgctccggctccgt
acgaccgtcggccgtgtgctgccggccgacgaccacgtcgacgccgtcctcaccgaccac
gccaccggtacgaccggcaccgtacgggcccggttcctggtcgcctgcgacggcgccgcc
tctcccgtccgccggtcctgcggcatcgacgcgcccgcgcgccaccgtacgcaggtgttc
cgcaacatccttttccgcgcacccgagttgaggaagcagctcggcgaccgcgccgccctc
gtccacttcctcatgctctcgtccaccctgcgtttccccctgcgcgcgctgaacgggagc
gatctctacaacctggtcgtgggcgtcgacgacagcgacagtgacagcgacaccggcgtt
gtcgacgcgttgtcgctgatcagggacgccctcgcccttgacaccccggtcgagctgctg
agcgacggcgcgtggcatctcacccaccgggtcgcggaccggtaccgcgccgggcgcgtc
ctgctggccggggacgccgcgcacaccctgtcgccctccggcggcttcggactcaacacc
ggtgtggccgacgctgccgacctgggctggaaactcgccgccgtgctggacggctgggcc
gggcgccggctgctcgacacgtacgagaccgagcgcagaccgatcgccgtggagagtctg
cacgaggcccacctcaacctccagcgcaccctgcgcagacgggtgccgcccgagatccac
ctggacggacccgagggcgagcgggcccgtgcggagatggcgcggcggctggagagcggc
aacgtacaaagggagttcgacgctccggagatccatttcgggctgcgctaccgctcgccg
gccattatcgaggaccccggtgtaccggcccgggacggcaagccggacgccgcctggcgc
cccggcagcgagcccggttaccgggccgcgcacgcgtggtgggacgccaccacctccaca
ctggacctgttcgggcgcggcttcgtcctgctggccttcaccaagggcgcggagcacgcc
gcgcacggccaactcgcgcggatcgaacgggcgttcgccgaccggggtgtgccgttcacc
gtacgcgagggcggtgacgggccggtcgccgcgctctacgaacggtcctatgtgctcgtc
cggccggacggtcatgtggcgtggcgcggcgacgaactgccccgggatccggtggagttc
gtcgacaccgtacggggcgaccggtga

DBGET integrated database retrieval system