KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_2065
Entry
SPD_2065          CDS       T00413                                 
Symbol
comC1
Name
(GenBank) competence-stimulating peptide type 1
  KO
K12415  competence-stimulating peptide
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd02020  Two-component system
spd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:spd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPD_2065 (comC1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SPD_2065 (comC1)
SSDB
Motif
Pfam: ComC DUF5836 Bacteriocin_IIc
Other DBs
NCBI-ProteinID: ABJ55363
UniProt: A0A0H2ZQ41
Position
complement(2042838..2042963)
AA seq 41 aa
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
NT seq 126 nt   +upstreamnt  +downstreamnt
atgaaaaacacagttaaattggaacagtttgtagctttgaaggaaaaagacttacaaaag
attaaaggtggggagatgaggttgtcaaaattcttccgtgattttattttacaaagaaaa
aagtaa

DBGET integrated database retrieval system