KEGG   Solanum pennellii: 107012939
Entry
107012939         CDS       T04130                                 

Name
(RefSeq) (-)-camphene/tricyclene synthase, chloroplastic
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
spen  Solanum pennellii
Pathway
spen00902  Monoterpenoid biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    107012939
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     107012939
    4.2.3.16  (4S)-limonene synthase
     107012939
    4.2.3.105  tricyclene synthase
     107012939
    4.2.3.117  (-)-camphene synthase
     107012939
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 107012939
NCBI-ProteinID: XP_015068401
Position
1
AA seq 607 aa
MSIFSTRYLVTPFSSFSPPKAFVSKACSLSTEQALNYSPNISTNLISSSNGIINPIRRSG
NYEPTMWNYEYIQSTHNHHVGEKYMKRFNELKAEIKKHLMMMLHEESQELEKLELIDNLQ
RLGVSYHFKDEIIQILRSIHDQSSSEATSANSLYYTALKFRILRQHGFYISQDILNDSKD
EQGHFKQSLCKDTKGLLQLYEASFLSTKSETSTLLESANTFAMSHLKNYLNGGDEENDWM
VKLVRHALEVPLHCMMLRVETRWYIDIYENIPNANPLLIELAKLDFNFVQAMHQQEIRNL
SRWWKKSMLAEKLPFARDRIVEAFQWIAGMIFESQENEYCRTMLTKVTAMATVIDDIYDV
YGTLDELEIFTHAIQRMEIKAMDELPDYMKLCYLALFNTSSEIAYHVLKEQGINIMPYLT
KSWADLSKSYLQEARWYYSGYTPSLDEYMENAWISVGSLVMVVNAFFLVTNPITKEVLEY
LFSNKYPDIIRWSATIIRLTDDLATSSNEMKRGDVPKSIQCYMKENDASEEDARKHINLM
IKETWKMINTAQHDNSLFCEKFMGCAVNIARTGQTIYQHGDGHGIQNSKIQNRISKLFFE
PITISIP
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtcaatattctccacaagatatttagttacccctttttcatcatttagcccaccaaag
gcctttgtatcaaaagcctgcagcctctccactgaacaggcacttaattattctcctaat
atttccactaatctaatttcgtcttcaaatggaataattaatcctattaggcgttcaggg
aattacgagcctaccatgtggaattatgaatatattcagtccacacacaatcatcatgtg
ggagagaagtatatgaagcgatttaacgagctgaaggcagaaataaaaaagcatttgatg
atgatgcttcatgaggaatcacaagaattagagaagttggagttgattgataatttacaa
aggcttggagtgagttaccacttcaaagatgaaattattcaaatattaaggagcatacat
gatcaaagtagtagtgaagccacgtcagcaaattcattatattacactgcattgaaattc
aggatcttgagacaacatggattttatatctctcaagatatattaaacgattccaaggat
gagcaaggtcacttcaagcaaagtctatgtaaagatacaaaagggttgttacaattatac
gaagcttcatttctctctacaaaatctgaaacctctactttattggaatcagctaataca
ttcgcaatgtcacatctcaaaaactatttaaatggtggtgatgaagagaatgattggatg
gtgaaactagtgcgccatgccctggaagttcctttgcattgcatgatgctaagagttgag
acaaggtggtatattgacatttatgaaaatatcccaaatgctaatcctctcctgatcgag
cttgctaagttggatttcaattttgtgcaagcaatgcaccaacaagaaataagaaatcta
tcaaggtggtggaagaagtcaatgcttgcagaaaaattaccatttgcaagggatagaatt
gttgaagctttccaatggatagctggcatgatttttgaatctcaagaaaacgaatattgt
cgaacaatgttgacaaaagtcactgctatggctacagttatagatgacatttatgatgtt
tacggcactcttgacgaattagaaatcttcactcatgctattcaaagaatggagataaaa
gcgatggatgagcttccagattatatgaaactatgttatcttgcactcttcaatacaagc
agtgaaattgcgtaccatgtccttaaagagcaagggatcaacatcatgccgtaccttaca
aaatcatgggcagatttatccaaatcttacttacaagaagcaagatggtactacagtgga
tatacaccaagtcttgatgaatacatggaaaatgcatggatttcagttggaagtttagtg
atggtagtgaatgcatttttcttagtcacaaatccaattaccaaagaggtattggaatac
ctattctcaaacaagtaccctgacataattcgttggtctgctacgattatccgtcttacc
gatgacttagctacatcatccaatgaaatgaaaagaggtgacgttccgaaatcaattcag
tgttacatgaaagagaatgacgcaagtgaagaagacgcaagaaaacatatcaatttaatg
ataaaggagacatggaaaatgataaacacagctcaacatgataattcattattttgtgaa
aaattcatgggttgtgcagtaaatattgcaagaactggacagaccatataccagcatgga
gacggacacggaattcaaaattctaaaattcagaatcgcatctccaaattattttttgag
cccatcactatttccattccataa

DBGET integrated database retrieval system