KEGG   Solanum pennellii: 107023247
Entry
107023247         CDS       T04130                                 

Definition
(RefSeq) neoxanthin synthase, chloroplastic
  KO
K14594  neoxanthin synthase [EC:5.3.99.9]
Organism
spen  Solanum pennellii
Pathway
spen00906  Carotenoid biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    107023247
Enzymes [BR:spen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.9  neoxanthin synthase
     107023247
Motif
Pfam: Lycopene_cycl Pyr_redox_2 FAD_binding_3 Thi4 HI0933_like FAD_binding_2 Trp_halogenase DAO Pyr_redox_3 Pyr_redox NAD_binding_8 GIDA NAD_binding_9 TrkA_N 2-Hacid_dh_C XdhC_C
Other DBs
NCBI-GeneID: 107023247
NCBI-ProteinID: NP_001310372
UniProt: F1BPW8
Position
6
AA seq 498 aa
MEALLKPFPSLLLSSPTPHRSIFQQNPSFLSPTTQKKSRKCLLRNKSSKLFCSFLDLAPT
SKPESLDVNISWVDPNSGRAQFDVIIIGAGPAGLRLAEQVSKYGIKVCCVDPSPLSMWPN
NYGVWVDEFENLGLEDCLDHKWPMTCVHINDNKTKYLGRPYGRVSRKKLKLKLLNSCVEN
RVKFYKAKVWKVEHEEFESSIVCDDGKKIRGSLVVDASGFASDFIEYDKPRNHGYQIAHG
VLVEVDNHPFDLDKMVLMDWRDSHLGNEPYLRVNNAKEPTFLYAMPFDRNLVFLEETSLV
SRPVLSYMEVKRRMVARLRHLGIKVRSVIEEEKCVIPMGGPLPRIPQNVMAIGGNSGIVH
PSTGYMVARSMALAPVLAEAIVEGLGSTRMIRGSQLYHRVWNGLWPLDRRCVRECYSFGM
ETLLKLDLKGTRRLFDAFFDLDPKYWQGFLSSRLSVKELGLLSLCLFGHGSNLTRLDIVT
KCPVPLVRLIGNLAVESL
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggaagctcttctcaagccttttccatctcttttactttcctctcctacaccccatagg
tctattttccaacaaaatccctcttttctaagtcccaccacccaaaaaaaatcaagaaaa
tgtcttcttagaaacaaaagtagtaaacttttttgtagctttcttgatttagcacccaca
tcaaagccagagtctttagatgttaacatctcatgggttgatcctaattctggtcgggct
caattcgacgtgatcattatcggagctggccctgctgggctcaggttagctgaacaagtt
tctaaatatggtattaaggtatgttgtgttgacccttcaccactctccatgtggccaaat
aattatggtgtttgggttgatgagtttgagaatttaggactggaagattgtttagatcat
aaatggcctatgacttgtgtgcatataaatgataacaagactaagtatttgggaagacca
tatggtagagttagtagaaagaagctgaagttgaaattgttgaacagttgtgttgagaac
agagtgaagttttataaagctaaggtttggaaagtggaacatgaagaatttgagtcttca
attgtttgtgatgatggtaagaagataagaggtagtttggttgtggatgcaagtggtttt
gctagtgattttatagagtatgacaagccaagaaaccatggttatcaaattgctcatggg
gttttagtagaagttgataatcatccatttgatttggataaaatggtgcttatggattgg
agggattctcatttaggtaatgagccatatttaagggtgaataatgctaaagaaccaaca
ttcttgtatgcaatgccatttgatagaaatttggttttcttggaagagacttctttggtg
agtcgtcctgtgttatcgtatatggaagtaaaaagaaggatggtggcaagattaaggcat
ttggggatcaaagtgagaagtgttattgaggaagagaaatgtgtgatccctatgggagga
ccacttccgcggattcctcaaaatgttatggctattggtgggaattcagggatagttcat
ccatcaacggggtacatggtggctaggagcatggctttagcaccagtactagctgaagcc
atcgtcgaggggcttggctcaacaagaatgataagagggtctcaactttaccatagagtt
tggaatggtttgtggcctttggatagaagatgtgttagagaatgttattcatttgggatg
gagacattgttgaagcttgatttgaaagggactaggagattgtttgacgctttctttgat
cttgatcctaaatactggcaagggttcctttcttcaagattgtctgtcaaagaacttggt
ttactcagcttgtgtcttttcggacatggctcaaatttgactaggttggatattgttaca
aaatgtcctgttcctttggttagactgattggcaatctagcagtagagagcctttga

DBGET integrated database retrieval system