KEGG   Solanum pennellii: 107029251
Entry
107029251         CDS       T04130                                 

Name
(RefSeq) 9-divinyl ether synthase
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
spen  Solanum pennellii
Brite
KEGG Orthology (KO) [BR:spen00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:spen00199]
    107029251
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     107029251
Cytochrome P450 [BR:spen00199]
 Cytochrome P450, plant type
  CYP74 family
   107029251
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107029251
NCBI-ProteinID: XP_015086117
Position
1
AA seq 478 aa
MSSYSELSNLPIREIPGDYGFPIISAIKDRYDYFYNQGEDAWFHNKAEKYKSTVVKINMA
PGPFTSNDYKLVAFLDANSFVCMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFIDTKDP
NHAALKGYILSSFAKRHNLFIPLFRNTLSDHLFNNLEKQVTEQGKSDLNALLPTMTFDFI
FRLLCDQKNPSDTVLGAQGPEHLRKWLFPQLIPSLSAKKLPNIIEDMLFHNFLIPFGFIK
SDYNKLVDAFSKSAVSMLDEAEKLGIKREEAVQNILFLVGINMFAGLNAFFPHLIRFVGE
AGASLHTQLAKEIRSVIKEEGGAITLSAINKMSLVKSVVYETLRLRPPVPLQYGKAKKEF
MVQSHDASYKINKGQFVVGYQPMASRDPKIFANPDEFVPDRFMNDGEKLLKHVLWSNGRE
TENPAPDNKQCPGKDLVHLLGRLILVEFFIRYDTFTVEITPLFRAPNVAFKTLTKASK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttcttattcagagttatcaaatcttccgattcgtgaaattccaggggactatggt
ttccctataattagcgcgattaaagatcgatacgattatttctataaccaaggtgaagat
gcttggttccataacaaagctgaaaaatacaaatctactgttgtcaaaatcaacatggca
ccaggtccattcacatctaatgactacaaattggtagcatttttagatgccaatagcttt
gtttgcatgtttgataattccctcattgataaaactgacactcttggtggtacatttaag
cctggtaaagaatactacggtggttatcgtcccgtcgcgtttatcgataccaaagatcca
aaccacgcagcattaaaaggctacattttatcatcattcgcaaagcgacataacttattc
attcctctgttcagaaacacattatccgatcatctttttaataatctcgaaaaacaggtt
actgaacaggggaaatcagatttgaatgctttgcttccaactatgacgtttgatttcatt
tttcgtttgctttgtgatcagaaaaatccgtctgatacagttcttggcgctcaaggacca
gaacatctacgtaaatggcttttccctcagctaattccgtccttgagcgccaagaaactt
cctaacatcatagaagatatgctcttccataattttttaataccatttggttttataaaa
agtgattacaacaaacttgttgatgcatttagcaagtctgctgtgtccatgttggatgaa
gcagaaaaacttggaatcaaaagagaagaagctgtacaaaacattctttttctcgtgggg
atcaatatgtttgcggggttgaacgcctttttccctcatctaatcaggtttgtgggcgaa
gcaggggctagtctacacacacaacttgctaaagaaatcaggagtgttattaaagaagaa
ggtggtgcaatcacattatcagcgattaacaaaatgagtttggtcaaatccgtagtgtac
gagacattgagacttcgcccaccagtaccattacagtatggtaaggcgaagaaagagttc
atggttcaaagccacgatgcatcttacaagatcaataaaggacaattcgtcgttggatat
cagcccatggctagtagggaccctaagattttcgcgaaccctgatgagtttgtacctgat
aggttcatgaatgatggtgagaaactgctgaaacatgttctgtggtctaatggaagggaa
acagagaatccagcaccagataacaagcaatgtccaggcaaagatttggtgcacctattg
ggtaggttaatattggttgaatttttcatcagatacgatacattcaccgtggaaattaca
cctctatttcgtgcgccaaatgttgcgttcaagacattaactaaagcaagtaaatag

DBGET integrated database retrieval system