Spirillospora sp. NBC_01491: OHA34_01000 Help Entry OHA34_01000       CDS       T09711                                  Name (GenBank) NUDIX domain-containing protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism spiq  Spirillospora sp. NBC_01491 Brite KEGG Orthology (KO) [BR:spiq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:spiq03400]     OHA34_01000 Enzymes [BR:spiq01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      OHA34_01000 DNA repair and recombination proteins [BR:spiq03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     OHA34_01000  Prokaryotic type     OHA34_01000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Hao_C NUDIX_2 Motif Other DBs NCBI-ProteinID:  WUU90408 UniProt:  A0AAU5WIH4 Position complement(214033..214437) Genome browser AA seq 134 aa AA seqDB search MTKLIDKVAWVHLEDGKILSTRSHGKDAFYLPGGKREPGESDIETLLREVDEELTVTVLA GTVARLGIYEARAHGRADDVTVRMTCYTGGFTGTLAPANEIAEIAWLTYADRPRVSPVDQ LIFDDLHASARLTT NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgacgaaactcatcgacaaggtggcctgggtgcacctggaggacggcaagatcctcagc acccgctcgcacggcaaggacgcgttctaccttcccggcggcaagcgggagcccggcgag agcgacatcgagacgctgctccgggaggtcgacgaggagctgaccgtcaccgtcctcgcc gggacggtcgcccgcctggggatctatgaggcccgggcgcacggccgcgccgatgatgtc accgtgcggatgacctgctacaccggcggcttcaccggcaccctcgcccccgcgaacgag atcgcggagatcgcctggctgacctacgccgaccgccctcgcgtctccccggtcgaccag ctcatcttcgacgatctgcacgcctccgcccgtctcaccacctga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (3) Pfam (3) All databases (5) Download RDF

DBGET integrated database retrieval system