KEGG   Streptomyces pluripotens: LK06_002085
Entry
LK06_002085       CDS       T04845                                 

Name
(GenBank) cytochrome P450
  KO
K19628  biflaviolin synthase [EC:1.14.19.69]
Organism
splu  Streptomyces pluripotens
Brite
KEGG Orthology (KO) [BR:splu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:splu00199]
    LK06_002085
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.69  biflaviolin synthase
     LK06_002085
Cytochrome P450 [BR:splu00199]
 Cytochrome P450, bacteria type
  CYP158 family
   LK06_002085
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ARP68938
UniProt: A0A221NTM9
Position
500011..501231
AA seq 406 aa
MTEETTLTDQAPPPVRDWPALDMDGTDFDPVLAGLMREGPLTRIRLPFGEGWAWLATRYD
DVKLITNDPRFSRTEVTRRQVTRLAPNFAPRPGSLAWADQPDHNRLRKPVAGAFTVSSMK
RLRPRAQAILDVLVDGVLQDGPPADLIERVLEPFPITVVSEVMGVPAGDRDQVHAWTRQI
ISTSGGSEAADKAKKGLYGWITAVVRARADNPGEDVYALLGGAVARGEVSEQEAVGLAGP
LQIGGEAVTHNCGQMLFLMLTRPELMERMRTRPEARGPVLDELLRYIPHRTSVGLSRIAL
EDVEIAGHRIAAGEPVYVSYLAANYDPDVFPDPDRIDPDRDPNPHVAFGNGPHFCTGAVL
ARLQIELLVDTLLERLPGMRLAVPPEQVQWRHKTMIRGPQTLPVTW
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaccgaggagaccacactcaccgaccaggccccaccgcccgtacgggactggcccgcg
ctcgacatggacgggacggacttcgacccggtcctcgccggactcatgcgcgagggcccc
ctgacccggatccggctgcccttcggcgagggctgggcctggttggcgacccgctacgac
gacgtgaaactgatcaccaatgacccccggttcagccgcaccgaggtgacccgccgtcag
gtcacacgtctcgcaccgaacttcgccccccgtccaggctcgttggcctgggccgaccag
cccgaccacaaccgactgcgcaaaccggtcgccggcgccttcacggtcagttccatgaag
cggctacgaccccgcgcgcaggcgatcctggacgtcctggtggacggggtcctccaggac
gggccgcccgccgatctgatcgagcgggtgcttgaaccgttcccgatcaccgtggtcagc
gaggtgatgggagtgcccgccggtgaccgggaccaggtgcacgcgtggacgcggcagatc
atctccacctccggcggctccgaggctgcggacaaggcgaagaagggcctgtacggctgg
atcaccgcggtggtccgggcccgtgccgacaacccgggtgaagacgtgtatgcgctgctc
ggcggtgcagtggcacgcggggaggtcagcgagcaggaggccgtcgggctcgccgggccg
ctgcagatcggcggcgaagccgtcacgcacaactgcgggcagatgctgtttctgatgctg
acccgtccagagctgatggaacggatgcgaacgcgccccgaagcacgggggcccgtgctg
gacgagttgttgcgctacatcccgcaccgcaccagtgtgggcctctcccggatcgcgctg
gaggacgtggagatcgccggccaccggatcgccgcgggcgagccggtgtacgtctcctat
ctggccgccaactacgatccggacgtctttccggacccggaccgcatcgatcccgaccgc
gacccgaacccgcacgtggcgttcggcaacgggccgcacttctgcaccggggcggtgctg
gcccgactccagatcgaactgctggtggacacactgctggagcggctgcccgggatgcgg
ctcgccgtaccacccgagcaggtgcagtggcggcacaagacgatgattcgcgggccgcag
accctgcccgtcacctggtga

DBGET integrated database retrieval system