KEGG   Serratia inhibens: Q5A_016900
Entry
Q5A_016900        CDS       T04576                                 

Name
(GenBank) hypothetical protein
  KO
K22113  fumarate---(S)-2,3-diaminopropanoate ligase [EC:6.3.2.46]
Organism
sply  Serratia inhibens
Pathway
sply00998  Biosynthesis of various antibiotics
sply01100  Metabolic pathways
sply01110  Biosynthesis of secondary metabolites
Module
sply_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    Q5A_016900
Enzymes [BR:sply01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.46  fumarate---(S)-2,3-diaminopropanoate ligase
     Q5A_016900
SSDB
Other DBs
NCBI-ProteinID: ANS43823
UniProt: A0A1B1KTU8
Position
complement(3560951..3562123)
AA seq 390 aa
MNLELWVKNIGATFPWYAQLLGDKQADASRLETLPVITEELLTQHYYHADHKLPGQYHSY
LTSGTTSGKRKRILYSDNDQRIYLQQRMGIIRDFCGEGHVRACADLGTGHAAATAGEIFQ
AMGCEVELIDFTRPIEQHIEVLNRFKPDIFFTMPMILDCLIATGKLDFQPKRIIVLGDVA
SLAWQRKVADYFHIKPGQVLDLFGSIEIGSIAFFDHALGRYRFDPYLLPEVVPVQSLYPD
AGYRGEGGILLLTSFAREYFPAVRFVTNDLIEGFAQETLEGRTVYTYQRCLGRFAGEFKH
GEKINLSDISDAMAKNLPYHRYDLDDHDGGLVIRIAAASIPAQVSEAIKHDLLSRNPDIA
QMIASGLVGDIRIQCVDAQEIAGNVSKRRY
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaatttggaactatgggtaaaaaacattggcgccacattcccctggtatgcgcaattg
ctcggcgacaagcaggcggacgccagccgtctggagacgctgccggtgattaccgaggaa
ctgctgacgcagcattactatcatgcggatcataagttgcccgggcagtatcacagctat
ctgacctccggcaccacgtcaggcaagcgtaagcgcattctttattccgataacgatcag
cgtatttatttgcaacagcgcatgggcattatcagggatttttgtggggaagggcatgtt
cgcgcctgtgccgatttgggcaccggccatgcggccgcgacggccggcgaaatcttccag
gcaatggggtgcgaggtcgaattgatcgatttcacccggccgattgagcaacatatcgag
gtgctcaaccgcttcaagcccgacatcttctttaccatgccgatgatacttgattgtctg
atcgcgaccggcaaactcgatttccaaccgaagaggatcatcgtgctgggtgacgtggca
agcctggcctggcaacgcaaggtggcggactattttcatatcaaaccggggcaggtactc
gatctgttcggcagcattgaaatcggctccatcgctttctttgatcatgcgctggggcgc
taccggttcgatccttacctgttgccggaagtggtgccggtgcaaagcttgtatcccgat
gccggctaccgcggcgaaggcggtattttactgcttacctcatttgcccgtgaatacttc
cctgccgtccgctttgtgaccaacgatttgattgagggttttgcacaggagaccctcgag
ggacgaacggtttacacctatcagcgctgccttgggcgttttgccggtgaatttaaacat
ggggagaaaatcaacctcagcgatatcagtgatgctatggcaaagaacctgccttatcac
agatacgatctcgacgatcatgacggcggattggtgattcgcattgcggcggcgtcgatc
ccggcacaggtcagcgaagctatcaagcatgacctgttgtcgcgcaaccccgatattgcg
caaatgatagcttcgggactggtcggggatatccgcatccagtgcgtcgacgcgcaggaa
atcgccggcaacgtcagcaaacgccgctattga

DBGET integrated database retrieval system