KEGG   Serratia inhibens: Q5A_016905
Entry
Q5A_016905        CDS       T04576                                 

Symbol
purD_2
Name
(GenBank) Phosphoribosylamine--glycine ligase
  KO
K22114  dapdiamide synthase [EC:6.3.2.47]
Organism
sply  Serratia inhibens
Pathway
sply00997  Biosynthesis of various secondary metabolites - part 3
sply01100  Metabolic pathways
sply01110  Biosynthesis of secondary metabolites
Module
sply_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Q5A_016905 (purD_2)
Enzymes [BR:sply01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.47  dapdiamide synthase
     Q5A_016905 (purD_2)
SSDB
Motif
Pfam: ATP-grasp_4 GARS_A RimK ATP-grasp_3 LAL_C2 GSH-S_ATP
Other DBs
NCBI-ProteinID: ANS43824
UniProt: A0A1B1KTR0
Position
complement(3562134..3563408)
AA seq 424 aa
MPILNNKEVIVIIDAWSGGKYLIPAFQALGYFCLHVQSPFLPAVFVADNQLAIARSDRHI
VHDGDIETLLNTLQPYAIKAILAGSEGAVALADRLNDALALAFSNRFELSAARRNKFLMQ
EQLARRGVASIMQRLTADCDELQQWLASHDRWPVVLKPVQSAGTDGVFICHDLAQAIQAF
DAILAKKDLFGSPNREVLCQEFLAGEEFVINGIACQGEYFFTELWQSKKQQRNGFPVYET
QYLHYRNDAGFDVLAAYTAQVCQALGIENGAFHAEVMMTPSGPVLIEIGARVAGGADPYI
IEECLGHSQIGKLVQAVLHPEVFLQEVRRQRDFSGHRRAAYVFMISPSTGRVQSSPEARF
IAIDGVISVNYHHVPGDIQQETRDLLSSPGVVIAIRDNPALLKQTIAEIRDVEGDFYHSG
LMVE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgccgattttgaacaacaaagaagtcatcgtgattattgacgcctggtccggcggcaaa
tacttgatccctgcatttcaggcgctcgggtatttttgcctgcacgtccaatccccgttt
ctgccggcggtcttcgttgcggataaccaactggccattgcccgcagcgacaggcatatc
gttcacgatggcgatattgagacgctgctcaacacgctgcaaccctatgccatcaaggcg
atactggccggcagcgagggcgcggttgcactggccgatcgcttgaatgatgctctggcg
ctggcctttagcaatcggttcgaactctccgcggcgcggcgtaataaattcctgatgcag
gaacagcttgcccgccggggtgtggcgtccatcatgcagcggctgactgctgactgtgat
gagttgcagcagtggctggccagccacgatcgctggccggtggtgctgaaaccggtgcaa
agcgccggtaccgacggggtgtttatctgccatgacctggcgcaggccatccaggcgttt
gacgctattctggccaaaaaagatctcttcggcagccctaaccgggaagtgctgtgccag
gaatttttggcgggcgaagagtttgtgatcaacggcattgcctgccagggagagtatttc
tttaccgagttgtggcagtcaaaaaagcaacagcgcaacggttttccggtgtatgaaacg
caatatctgcactatcggaatgacgccggcttcgatgtgttggccgcctataccgcgcaa
gtgtgccaggcgcttggcatcgagaacggggcctttcatgccgaggtgatgatgacgccg
agcgggcctgtgttgattgaaatcggcgcccgggtcgccggcggtgcggacccttatatt
atcgaagagtgtctggggcattcgcagataggcaaattggtgcaggcagtcctgcaccct
gaggtgttcctgcaggaggttcggcggcagcgcgatttttccggccatcggcgcgccgcc
tatgtcttcatgatttcgccctccacgggccgggtgcaaagctcgcctgaagcgcgattt
atcgctatcgacggcgttatcagcgtcaattatcaccacgtgcccggtgatattcagcaa
gagacccgcgacctgctgagctcccctggggtggttattgccatccgggataaccctgcc
ttgctaaagcagacgattgcggagatccgcgatgtcgaaggtgatttttaccactcgggc
ctgatggttgaataa

DBGET integrated database retrieval system