KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23A1.15c
Entry
SPAC23A1.15c      CDS       T00076                                 

Gene name
sec20
Definition
(RefSeq) putative SNARE protein Sec20
  KO
K08497  protein transport protein SEC20
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SPAC23A1.15c (sec20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC23A1.15c (sec20)
Membrane trafficking [BR:spo04131]
 SNARE
  SNAP-25[N] (Qb)
   Sec20
    SPAC23A1.15c (sec20)
SSDB
Motif
Pfam: Sec20 GDI
Other DBs
NCBI-GeneID: 2541996
NCBI-ProteinID: NP_594444
PomBase: SPAC23A1.15c
UniProt: O42852
Position
I:complement(4103942..4104622)
AA seq 226 aa
MADVLNALEEKVVELQQSESVEVIKRHFREFRKIWETARVELEYSSIQLDSVLRYEKAVQ
EYIRLNRRYRNKIASGEPWLPIAQEIGKIVDEEEITSPSDGSLQKRSMDNSGSWQSDDIY
LTSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRII
KSLKLSDRSDYFLVVSGFGFFIFVVVYLLFKRIVWPILSMFLWFLR
NT seq 681 nt   +upstreamnt  +downstreamnt
atggccgacgttctgaatgcactagaagaaaaagttgttgaattacaacagtcagaaagc
gttgaagttattaaaaggcattttcgagagtttagaaaaatatgggaaactgcaagggta
gagcttgaatactcatccattcagctagactcagttctacgatatgaaaaggctgtacaa
gaatacattcggttgaacagaagatatcggaataagattgctagtggtgaaccatggttg
cctatcgcacaagaaataggtaagattgtagatgaagaggaaattacctcaccaagtgat
ggttctcttcaaaagcgttcaatggataactctggttcgtggcaatctgatgatatttat
cttacaagcgccagtcaggtcacggcggctatgcgtgatattcacgcacaaatggtacag
gcagtggatatgagtgccgaaaatgcaatggagttgtcttcgagtaccaacttgttagaa
actctacaagagaaatattttggtgtagaggacgttttatatacaagtaaacggataatc
aaatcgctcaaattaagtgatcgaagtgattactttttagtcgtctcgggatttgggttc
ttcatatttgtggttgtctatcttctcttcaagcgaattgtctggcctattctttctatg
tttctttggtttcttcggtga

DBGET integrated database retrieval system