KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23C4.13
Entry
SPAC23C4.13       CDS       T00076                                 

Gene name
bet1
Definition
(RefSeq) putative SNARE protein Bet1
  KO
K08504  blocked early in transport 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SPAC23C4.13 (bet1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC23C4.13 (bet1)
Membrane trafficking [BR:spo04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    SPAC23C4.13 (bet1)
SSDB
Motif
Pfam: Use1 Syntaxin_2 Sec20 CoV_S2 DUF1664 Pex24p VPS38 DUF4208 bZIP_1 DUF6254
Other DBs
NCBI-GeneID: 2542068
NCBI-ProteinID: NP_593185
PomBase: SPAC23C4.13
UniProt: O13932
Position
I:join(1051729..1051739,1051783..1051921,1051971..1052174)
AA seq 117 aa
MGSRFGRRKERNGDMLPLYESQSPQHLDSLENENDERISKLTGKVKSLKELTMNIGTEIT
SSTKLMESMNDSFDSTKSLLSGTMTRLKNVSKNGGISIWMWLAFFCLVALILVLVRF
NT seq 354 nt   +upstreamnt  +downstreamnt
atgggatcaagattcggtagaagaaaagaacgcaatggcgatatgttgcccttgtatgag
tctcaatctcctcagcatttagactccttggaaaatgaaaatgatgaacggatttcaaag
ttaactggaaaagtcaagtctttgaaagagcttactatgaatattgggactgagataacg
tcttctactaagttgatggagtcaatgaacgactcatttgactcgaccaagtcacttttg
agcgggacaatgactcgattaaagaatgtttcgaagaatggaggaatttcaatttggatg
tggctcgccttcttttgcctcgttgcgcttatcctcgttttggtaagattttag

DBGET integrated database retrieval system