KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4A8.02c
Entry
SPAC4A8.02c       CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: UPF0047
Other DBs
NCBI-GeneID: 2543398
NCBI-ProteinID: NP_593813
PomBase: SPAC4A8.02c
UniProt: O14155
Position
I:complement(join(2540247..2540642,2540693..2540725))
AA seq 142 aa
MDVIQRIITLDRRSKGFYIITNDLVKKLPELKSFSSGTVNFFIQHTSAALTINENWDADT
RADMNDILDKIVPESAGYRHTAEGLDDMPAHVKSSLIGPSLTVPITNGKLSLGTWQDIQL
AEFRRQPHSRTIVCTIIGLRSN
NT seq 429 nt   +upstreamnt  +downstreamnt
atggatgttattcaacgcattataactttagatagaagatccaaagggttttacataatt
acaaacgatttggtcaaaaagcttccagaattaaaaagcttttcttctggtacagtaaat
ttttttatacagcatacctctgctgctcttactatcaatgagaattgggacgcagatacg
cgagctgacatgaacgatatattggataaaattgtccctgaatcagcaggctaccgtcat
actgcagaaggattagacgatatgcctgctcatgttaaatctagcttaattggacctagt
ttaactgttcccattactaatgggaagttgagcttgggtacttggcaagacattcagtta
gctgagtttcgtcgccaacctcattctcgtacaattgtttgtactattataggtttacga
agcaattga

DBGET integrated database retrieval system