KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3B9.10
Entry
SPBC3B9.10        CDS       T00076                                 

Gene name
vti1
Definition
(RefSeq) putative SNARE protein Vti1
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04130  SNARE interactions in vesicular transport
spo04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SPBC3B9.10 (vti1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPBC3B9.10 (vti1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC3B9.10 (vti1)
Membrane trafficking [BR:spo04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    SPBC3B9.10 (vti1)
SSDB
Motif
Pfam: V-SNARE_C V-SNARE Sec20 DUF677 FliJ YqjK Prominin DUF5623
Other DBs
NCBI-GeneID: 2540970
NCBI-ProteinID: NP_596668
PomBase: SPBC3B9.10
UniProt: P78768
Position
II:join(4004957..4004982,4005020..4005125,4005172..4005282,4005388..4005639,4005804..4005865,4005941..4006028)
AA seq 214 aa
METYEQEYRLLRADIEEKLNDLSKSGENSVIQSCQRLLNEIDEVIGQMEIEITGIPTSER
GLVNGRIRSYRSTLEEWRRHLKEEIGKSDRKALFGNRDETSGDYIASDQDYDQRTRLLQG
TNRLEQSSQRLLESQRIANETEGIGASILRDLHGQRNQLEHSLEMLGDTSGHLDRSLRTL
KTMARRLAMNRFFTTAIIAILVILILLVLYSKFR
NT seq 645 nt   +upstreamnt  +downstreamnt
atggagacgtacgagcaagaatatcgcttgcttcgagcagatatcgaagaaaaacttaat
gatttaagtaaaagtggtgagaactctgttattcaatcatgtcagagacttttaaatgaa
attgatgaagtaattggtcaaatggaaattgaaattaccggtatccctacttctgaaaga
ggtctcgtaaatggaagaattcgtagttatcgttcaactttggaggagtggcgtagacac
ctgaaggaagaaattggcaaatcagataggaaagccctttttggaaatagggatgaaaca
tccggtgattatattgcaagtgatcaagattatgaccaaagaactcgtttgttacaagga
acaaatagacttgagcaatcttcacagcgtcttcttgaatcacaacggattgcgaatgag
actgaaggcattggtgctagcattcttcgtgatcttcatggtcaaagaaatcaattggag
cattctttagagatgcttggagatacgtctggacaccttgatcgaagtttaagaactctg
aagacaatggcaagaagacttgccatgaacagatttttcacgacagcaataattgcaatc
cttgttatattaattttgcttgtgctttatagcaaatttcgttag

DBGET integrated database retrieval system