KEGG   Schizosaccharomyces pombe (fission yeast): SPCC895.04c
Entry
SPCC895.04c       CDS       T00076                                 

Gene name
ufe1
Definition
(RefSeq) putative SNARE protein Ufe1
  KO
K08492  syntaxin 18
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04130  SNARE interactions in vesicular transport
spo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SPCC895.04c (ufe1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    SPCC895.04c (ufe1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPCC895.04c (ufe1)
Membrane trafficking [BR:spo04131]
 SNARE
  Syntaxin (Qa)
   Stx-rER
    SPCC895.04c (ufe1)
SSDB
Motif
Pfam: Syntaxin-18_N FUSC-like DUF16 Suppressor_APC SNARE Hmw_CFAP97 SPACA9 ECM11
Other DBs
NCBI-GeneID: 2538886
NCBI-ProteinID: NP_588045
PomBase: SPCC895.04c
UniProt: O94531
Position
III:complement(join(1001020..1001624,1001713..1001947,1002145..1002264))
AA seq 319 aa
MTSRTNEFFGLTKNGDIDAANIPLKRISYTDPFLAEGYRIHETIVNLLVFLKKIRGAYLK
DRTFSNVQRLSKPLMECSLEELSKLELDEVQRDEIEHEVSSAISSCIHQIAKLQEIVKEQ
QSQIPKKSGWLQGLRDPSKLSKKETLVAHHSSVLWYLQSELSDVSSVLYHLQDLRLKRGQ
EKRNIASDFLTKNPTDENSAVEIPESELQTFFTQQQLQELEQENDVLLQEFEHTMERLRD
TGKSLADITRLQSEISAQLSIQSSAAEKLYDDALNVMDSLSGGNQQLIKAKSRSSRTARL
LFCIFTVMGLLLLSLDRIV
NT seq 960 nt   +upstreamnt  +downstreamnt
atgacgagtcgtacgaatgagttttttggattaacaaaaaatggcgacattgatgcagca
aacattcctttgaaaagaataagttatacggatccttttttggctgaaggatatagaatt
catgaaacgattgttaatcttctagtatttttgaaaaagattcgtggagcttatttaaag
gacagaacattttcaaatgtccaaagactctcaaaacctttaatggagtgttcacttgag
gagctttcaaagcttgagctagatgaggttcaaagggatgaaatagaacatgaagtctct
tcggcaatcagtagctgtattcatcaaatagctaagttgcaggagattgtgaaagaacaa
caaagtcaaatccctaaaaaaagtggttggctgcaaggtttaagagaccctagtaaatta
tcgaaaaaggaaactttagtcgcccaccattcatctgttctgtggtatctgcagtctgaa
ctttccgatgtttcttctgttctatatcatttacaagatctgagattaaaacgaggtcag
gaaaagcgaaacattgcttcagactttttaacaaaaaatcctactgatgaaaattcagct
gttgagatccctgaatctgaattacaaacattttttactcaacagcaacttcaagaactt
gagcaagagaacgatgttttactccaagaatttgaacatactatggaacgtttacgtgat
acagggaaatctttggctgatattactagacttcagtcggaaatatccgctcaactatct
attcaatcaagtgcggctgaaaaactttatgatgatgcccttaatgtcatggattcgctg
tctgggggtaatcaacaactaatcaaggccaaatctagaagtagtcggaccgctcgtctg
cttttttgcatctttaccgttatgggacttttattgctatccttggatcgtattgtttaa

DBGET integrated database retrieval system