Staphylococcus shinii: JMB28_14020 Help Entry JMB28_14020       CDS       T08256                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism spsd  Staphylococcus shinii Pathway spsd00362   Benzoate degradation spsd00622   Xylene degradation spsd01100   Metabolic pathways spsd01120   Microbial metabolism in diverse environments spsd01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:spsd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     JMB28_14020    00622 Xylene degradation     JMB28_14020    00621 Dioxin degradation     JMB28_14020 Enzymes [BR:spsd01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      JMB28_14020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  QRA18092 Position p14AME19-3:1142..1327 Genome browser AA seq 61 aa AA seqDB search MPILKLETLDLTKDQKKQLVEELTETASRITGIPKEGYYVILKENNLDNVGSGGKLLSDQ E NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccaattttaaaattagaaacactagatttaacaaaagatcaaaaaaagcaactagtt gaggaattaacagaaactgcttcacgtattactggaatccctaaagaaggatattatgtt attttaaaagaaaacaacttagataacgtgggttctggaggaaaattattaagtgatcaa gaatag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (2) Pfam (2) All databases (3) Download RDF

DBGET integrated database retrieval system