KEGG   Streptomyces qinzhouensis: FQU76_32190
Entry
FQU76_32190       CDS       T06686                                 

Name
(GenBank) hypothetical protein
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
sqz  Streptomyces qinzhouensis
Pathway
sqz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:sqz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FQU76_32190
Enzymes [BR:sqz01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     FQU76_32190
SSDB
Other DBs
NCBI-ProteinID: QDY80407
UniProt: A0A5B8JFK9
Position
complement(7704762..7705760)
AA seq 332 aa
MSAPVAAPYCRFEKIVPSDFEGDETVLGVIEHGTGHTEVSLTDGVPRSAVHTTTLEEEAF
AEVWRARPSIESGRDGGIAWARTDAYLFGIGRVPERLGYADPVSALYTEIFGLTRSLGYP
RLARTWNYISRINSANADGLEVYRDFCVGRAQALDAGGIDPAGMPAATGIGAHGGGITCV
FLAARGGTRINIENPAVLTAHRYPPAYGPRAPVFARATWLGPPGGSRLFVSATAGILGHE
TTHHGDVAGQCEVALDNIARVVAAENLRRHGVRRGYVLTDVDHLKVYVRRRADLPAVRRV
CAARLSSTATVAFLHTDIARGDLLVEIEGVVS
NT seq 999 nt   +upstreamnt  +downstreamnt
ttgtctgcacctgtcgcggcaccgtactgccgcttcgagaagatcgtgccgtcggacttc
gaaggggacgagacggtgctcggtgtcatcgagcacggcaccggtcacaccgaggtgtcg
ctgacggacggtgtcccgcgttccgcggtgcacaccacgaccctggaggaagaggcgttc
gccgaggtctggcgggcgcggccgtccatcgagtccggccgggacggaggcatcgcgtgg
gcccgcaccgacgcgtacctgttcggtatcggccgcgtccccgagcgcctcgggtacgcc
gaccccgtctcggcgctctacacagagatcttcgggctcacccggtccctggggtatccg
cggctcgcccggacgtggaactacatcagccgtatcaactcggcgaacgcggacgggctc
gaggtgtaccgggacttctgcgtgggccgtgcccaggcgctggacgcgggcgggatcgac
ccggccggcatgcccgccgccaccggcatcggcgcccacgggggcggcatcacctgcgtt
ttcctcgccgcccgcggcggaactcggatcaacatcgagaaccctgccgtcctcacggca
caccgttaccccccggcgtacggcccgcgcgccccggtcttcgcacgggcgacctggctg
ggcccgccgggcggtagccggctgttcgtctccgcgacggccggaatcctcgggcacgag
acgacgcaccacggtgacgtggccggtcagtgcgaggtcgccctggacaacatcgcccgg
gtggtggccgccgagaatctgcgccggcacggcgtccggcgggggtacgtcctcaccgac
gtcgaccacctcaaggtctatgtccggcgtcgcgcggacctcccggcggtccgccgggtc
tgcgccgcacgtctgtcgagcaccgcgaccgtcgcgttcttgcataccgacatcgcccgc
ggcgatctgctcgtggagatcgaaggagtggtttcgtga

DBGET integrated database retrieval system