KEGG   Streptococcus ratti: FY406_01950
Entry
FY406_01950       CDS       T06620                                 

Name
(GenBank) glycoside hydrolase 68 family protein
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
srat  Streptococcus ratti
Pathway
srat00500  Starch and sucrose metabolism
srat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FY406_01950
Enzymes [BR:srat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     FY406_01950
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig
Other DBs
NCBI-ProteinID: QEY06528
Position
complement(410740..413217)
AA seq 825 aa
MEKKVRKKMYKKGKFWVVAAVTTVAAASFATATVQADEVSPSQAASETVAANAQQNQTVP
STQEQQPVASANEAVSTDESAAKTETVSPAAATDEKAATPETEEKADTQAAPVQTTEASE
SNQMPAKQADEKTVSSAEAKTSAVQAATASSPEVKQPTADQAKATKELAASEEDNKTLDQ
YGLTEQAHKIATEAGLDLSTLTQKQVEALNKVKLTNDAQTGHQMTYQEFDKIAQTLLAQD
DRYAIPYFNAKAIKNMKAATTRDAQTGQVADLDVWDSWPVQDAKTGEVVNWNGYQLVVAM
MGIPNTNDNHIYLLYNKYGDNNFDNWKNAGPIFGFNADGVTQQWSGSATVNEDDSLQLFY
TKVDTSDQNSNNQHLATATINLGFDDQDVKILSVENDKDLTPQGGDGYHYQSYQQWRSTF
TGTDNIAMRDPHVIEDENGNRYLVFEASTGTENYQGEDQIYNFTNYGGSSSYNVKSLFRF
LEDQDMYNRASWSNAAIGILKLKGDEKTPEVDEYYTPLLSSPMVSDELERPNVVKLGDKY
YLFTASRLNHGSNNDAWNKANEVVGDNVVMLGYVSDQLTNGYKPLNNSGVVLTASVPADW
RTATYSYYAVPVAGSSDTLLITAYMTNRNEVAGKGKNSTWAPSFLLQVLPDGTTKVLAEM
TQQGDWIWDESSRTTDTVGTLDTAYLPGENDGYIDWNVIGGYGLKPHTPGQYQAPTVPST
PTNSGYTISFNVTADGKLVITPVKTDNTGSASQSGDSNWSLDVSFNASAGGNISVKADQT
PVKPTDQAKNTKKHHQASSNKKPKKGFFAALLAIFSAFCTGLGLK
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggaaaaaaaagttagaaaaaaaatgtacaaaaaagggaaattttgggtagttgctgct
gttacaacagttgctgcagctagttttgctactgcaactgttcaggcagatgaagtgagt
ccaagtcaagcagcttctgaaacagtcgctgcaaatgctcaacaaaatcaaacagtccca
tcaacacaagaacagcagccagtagcttctgccaatgaagcagtaagtacagatgaatct
gctgctaaaacagaaaccgtcagtccagcagctgcaactgatgaaaaagcagcgactcct
gaaacagaggaaaaggctgatacacaagcagctccggttcagacaacagaagcttctgag
tccaatcaaatgcctgctaaacaagctgatgaaaagaccgtcagttcagctgaagctaaa
acttcagctgttcaagcagcaacagccagctcaccagaggttaaacagccaactgctgat
caagctaaggcgactaaagaattagcggcttcagaagaagacaataagacccttgatcag
tatggtctgacagaacaagcacacaagattgcaacagaagctggtttggatttgagcact
ctgacgcaaaaacaagttgaggcacttaataaagttaagctgactaatgatgctcaaacc
ggacatcaaatgacctatcaagagtttgacaagattgctcaaacccttttagcgcaagat
gatcgttatgccattccttattttaatgctaaggctattaaaaatatgaaggcagcgaca
acgcgcgatgctcaaacaggtcaagtggctgatttagatgtttgggattcctggccagtt
caagatgctaagactggagaagtggttaattggaatggctatcaattggttgttgctatg
atgggtattccaaataccaatgacaatcatatttatcttctctacaataaatatggggat
aataactttgacaattggaagaatgccggtccaatctttggcttcaatgctgatggggtc
acacagcaatggtcaggctcagcaactgtaaatgaagacgacagtctgcaattattctat
actaaggttgatacgagtgaccaaaacagcaataatcaacatctggcaacagcaacgata
aatcttggttttgatgatcaagatgtcaaaattctttctgttgaaaacgacaaagaccta
actccgcaaggcggcgatggctaccactaccaaagctatcaacaatggcgttcaactttt
acaggtacagataatattgccatgcgtgacccgcatgttattgaagatgagaatggcaat
cgctatctggtctttgaagcaagtacaggtacagaaaactatcaaggcgaagatcaaatc
tataacttcaccaattatggcggcagctcttcttataacgttaagagtctctttagattc
ttggaagatcaggatatgtacaatcgtgccagctggtcgaatgcagccatcggtattttg
aaactcaaaggtgatgaaaaaactccagaagtagatgaatactatactcctttgcttagc
tcaccaatggtgtctgatgaattggagcggccaaatgtggttaagttaggcgataaatac
tatctctttactgcttcacgccttaatcacggaagtaacaatgatgcttggaataaggcc
aatgaggtagtcggtgacaatgttgtcatgctgggctatgtctctgatcaactgacaaac
ggctacaaacctttaaacaacagtggtgttgtcctgacagcatctgtgccggcagactgg
cggacggcaacatactcttattatgctgtaccagtggctggttcgtctgataccctcttg
attacagcttatatgactaaccgtaatgaagtagctggtaagggtaaaaattcaacttgg
gcacctagcttccttcttcaagttctgccagatggtacgactaaagttttggcagaaatg
actcagcaaggcgattggatttgggatgagtccagccgtacaacagatactgtcggtacg
ttggatacagcttatcttccgggtgaaaatgatggttatattgattggaatgttattggc
ggttacggtttgaaacctcatacaccaggacaataccaagcaccaacagttccatcaaca
ccaaccaattcaggttataccatttcctttaatgttactgcggatggcaaacttgttatc
acacctgtaaaaacagataacactggttctgctagtcagtcaggtgattccaactggtct
cttgatgtttcctttaatgcctcagctggcggaaatatttctgtgaaagcagatcaaact
ccagttaaaccaaccgaccaagcaaaaaatactaaaaaacatcatcaagcttcatcgaat
aaaaagcctaaaaaaggcttctttgcagctctactggctatctttagtgctttctgtaca
ggtcttggtttgaaataa

DBGET integrated database retrieval system