KEGG   Streptococcus ratti: FY406_08040
Entry
FY406_08040       CDS       T06620                                 
Name
(GenBank) hypothetical protein
Organism
srat  Streptococcus ratti
SSDB
Motif
Pfam: Choline_bind_3 Choline_bind_1 DUF1958 Choline_bind_2 Hamartin
Other DBs
NCBI-ProteinID: QEY07589
Position
complement(1601283..1603385)
AA seq 700 aa
MFMILLSFLTAVSIIQQKLHFTRDFLLLSLESLSYRKRDIFKHFTTPKRQIQIPDIVFLT
KQCHHLSSITDSYHLQSLRSKAQIACYNKGVDQYFALEEKRFFMIRQGDFKLARQKIKKH
RASIMGTAALLLSSLAAPVLAEDQTPVQSSSAIAQTTETVAKSASDHYSNSDLIKDSDQP
QGTNSVSNEAAQTQPPTTSQEDSQKQTAATTEETAVANKDSQTTAATTKEQATQKQSSAS
SQAQTTKDKKQTSAETKGFITKNNGKTYYIDQEGQTLTGFQTIDGQTYYFSTDGSLQKDR
LITVNDEIYYIDSQGHPAVNQFVQKAGSFYYLNEDGKALTGWQTIDGKQLYFAEKGKART
AAQYKGSLYTIDGDKYYFDPDSGEMWTNRFVNYIGNWYYLGSQGKVLTGYQTINNQSYYF
DKQGKQLKGIGYDDNGQIILTDRQSGIVLNQKIEKSQFYQNENNWYYLDENNQFAKGWQT
INGQRLYFNSDGSQVKGTMLTLNGKKYYLDPNSGEMWTNRFVSQKQYSDRYSSYYDVWYY
LGDDGAAVSGWQTIDGKQLYFYSDGSQAKGRLIQDQGKFYYFDPDSGEMWTNRFVYITPS
NNYYYQPVFSGWLYLGADGAALLGWQTIDGKQLYFQPSYNSKLGYSHQEGGQIKGELFEI
DGSLYYFDPDSGEKWTDRTLTYDGKTYHIDSQGKASLQQP
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgttcatgatactactttcttttttaactgctgtttctattatacaacaaaagttacat
tttacgcgtgattttcttttattatctttagagagcctgtcttatcgaaaaagagatatt
tttaagcattttactacccccaaaagacagatccagattccagatatagtttttttgaca
aaacagtgtcatcatctcagcagcattacagatagctatcatttacagtcactaaggagc
aaagcccaaatagcgtgctataataaaggtgttgaccaatactttgctttagaagaaaag
aggttttttatgataagacaaggggattttaaattagctagacaaaagataaaaaaacac
agagcatctatcatgggtacagccgcgttgctgctgagctccttagctgctccggtgttg
gccgaggatcagacacctgtacaaagcagctcagctattgcccaaactactgaaactgtt
gctaagtctgcttcagatcactattcaaattctgatttaatcaaagattccgatcagccg
caaggaactaatagtgtttctaacgaagcagcacaaactcagccaccgaccacttcccaa
gaggacagtcaaaaacaaacagctgccacaacagaagaaacggcggtggcaaacaaagat
agccaaacaactgctgctacaacgaaagaacaagccactcaaaagcagtcatcggcttct
tctcaagcacagacaaccaaagacaaaaagcagacctctgctgaaacaaagggatttatc
actaaaaataacggaaaaacttactacattgaccaagaaggccagactctcacaggcttt
cagacgattgacggtcagacctactatttttcaacagacggaagcctgcagaaggaccgg
cttattactgtaaatgatgaaatttactatattgactcacaaggacatccagctgtcaat
caattcgtccaaaaagctggcagcttctactatttgaacgaagacggaaaagcactcaca
ggctggcagactattgatggcaaacagctttacttcgctgaaaaaggcaaagctagaacg
gctgctcaatataaaggcagcctatacacgattgatggtgacaagtattatttcgatccg
gacagcggggaaatgtggactaatcgttttgtcaattatatcggcaactggtattacctt
ggcagtcagggaaaggttctcaccggctatcaaaccatcaataatcaaagctactatttt
gacaaacaaggcaaacagctaaagggtatcggctacgacgataatggtcagatcattttg
accgatcgtcaaagcgggatcgttctcaatcaaaaaatagaaaagagccaattctatcag
aatgaaaataactggtattatcttgatgagaataatcagtttgccaaaggctggcaaacc
atcaacggccaacgactgtattttaacagtgatggcagccaagttaaaggaacgatgctg
actcttaatggcaaaaaatattatcttgatccaaacagcggagagatgtggaccaatcgt
tttgtcagccaaaagcaatacagtgaccgctacagcagttactatgatgtgtggtattat
ttaggcgacgatggcgcagctgtttcaggctggcagactattgacggcaagcagctttat
ttttattctgacggcagtcaagctaaaggtcggctgattcaagatcagggcaaattttat
tattttgatccggacagcggagagatgtggaccaatcgttttgtttacatcacgccgtct
aacaattactattatcagcccgtttttagcggctggctttacttgggagcagatggtgcc
gcccttttaggctggcagactattgatggcaaacagctctactttcagccgtcctataat
agtaaactgggctattctcatcaagaaggtgggcaaatcaaaggagagctttttgaaatt
gatggcagtctctactattttgatccggacagtggcgaaaaatggactgaccgtactttg
acatatgatggcaagacctatcacattgattcccaaggcaaggcaagtctccagcagcct
taa

DBGET integrated database retrieval system