KEGG   Streptomyces rapamycinicus: M271_40655
Entry
M271_40655        CDS       T02907                                 

Name
(GenBank) hypothetical protein
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
src  Streptomyces rapamycinicus
Pathway
src00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M271_40655
Enzymes [BR:src01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     M271_40655
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: AGP59510
UniProt: Q54305
Position
complement(10045611..10046615)
AA seq 334 aa
MTPPVTAPYCRFEKLGASDLDGDETLLGVIEHRTGHTGVSLAEGCPRTAVHTTTREDESF
AEAWHAEGPKESGSHDGVAWARTPDYLFGVARVPEGGRYAAGTAAVYTGIFDLIGTLGYP
SLARTWNYVSGINTPNADGLEVYRDFCVGRAEALDARGIDPATMPAATGIGAHGGGITCY
FIAARAGDRVNMENPAVLTAHRYPQRYGPRPPVFSRATWLSPPGADDGRLFVSATAGIVG
HETVHHGDVAAQCEVSLENIARVIGAENLGRHGLRRGYALADVDHLKVYVRHREDISTVR
RICAERLSREATVAVLHTDIARTDLLVEIEGVVA
NT seq 1005 nt   +upstreamnt  +downstreamnt
ttgactccgccggtcacggcaccgtactgccgcttcgagaagctcggcgcctccgatctc
gacggcgacgagacacttctcggcgtcatcgaacatcgcaccggacacaccggggtttca
ctggccgagggctgtccccggacggccgtacacacgacgacccgcgaggacgagtcgttc
gccgaggcgtggcacgcggaggggccgaaggagtcgggcagccatgatggcgtcgcctgg
gctcggacacctgactacctcttcggtgtcgcgcgggtgcccgagggcggccggtacgcg
gccggcaccgcggccgtctacaccggaatcttcgacctgatcgggacgctggggtacccc
agtctggcccgcacctggaactacgtcagcggaatcaacacgccgaacgccgatggcctc
gaggtctaccgggacttctgtgtgggccgcgccgaggcgctggacgcccgtgggatcgac
ccggcgaccatgccggcggcgaccggcatcggcgcccacggcggcggcatcacgtgctac
ttcatcgccgcacgcgccggtgaccgggtcaacatggagaacccggccgtgctcacggct
caccgctacccgcagcggtacggcccccgcccgccggtcttctcccgggccacctggctc
tcgccgccgggggcggacgacggccggctcttcgtctccgcgaccgccggcatcgtcggt
cacgagacggtgcaccacggcgacgtcgccgcgcaatgcgaggtgtcgctcgagaacatc
gcccgggtgatcggtgccgagaacctgggacggcacgggctccgccggggctacgccctc
gccgacgtcgaccatttgaaggtctatgtacgccaccgcgaggatatttcgaccgtacgt
cggatctgcgccgagcgcctctcccgcgaggccacggttgccgtactgcacaccgacatc
gcgcgcaccgatctgctggtcgagatcgagggtgtggtggcgtga

DBGET integrated database retrieval system