KEGG   Streptomyces rectiverticillatus: FGW37_13085
Entry
FGW37_13085       CDS       T06927                                 

Definition
(GenBank) methyltransferase domain-containing protein
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
srk  Streptomyces rectiverticillatus
Pathway
srk00523  Polyketide sugar unit biosynthesis
srk01100  Metabolic pathways
srk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    FGW37_13085
Enzymes [BR:srk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     FGW37_13085
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_2 NodS
Other DBs
NCBI-ProteinID: QLE76066
Position
3019901..3020584
AA seq 227 aa
MYDLLYEDKKDYRSEAGQVARLIRAHRPDAAALLDVACGTGIHLQAFSELFAHVEGVDLA
EPMLAMAARRLPGVPLHVGDMRSFRPERSFDAAVCMFSSIAYMRSAADLDRAVATLAAAV
APGGVVLVEPWWFPESFLEGYVAGHALTRDGRTITRVSHSTRQGDMVRMELHYVLADAGG
VEHRSEVDMLTLFTREQYEEAFSRAGVKAEYAKSEGTGPGFFVGVRG
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtacgacctgctgtacgaggacaagaaggactaccggtcggaggccggccaggtggcc
cggctgatccgggcgcaccggccggacgccgcggcgctgctggacgtggcctgcggcacg
ggcatccatctgcaggcgttctcggagctgttcgcgcacgtggagggcgtggacctggcg
gagccgatgctggcgatggcggcgcggcgcctgccgggcgttccgctgcacgtcggggac
atgcggtcgttccgcccggagcgcagcttcgacgccgccgtctgcatgttcagctcgatc
gcgtacatgcgctcggccgcggacctggaccgggccgtcgcgacactggcggccgcggtg
gcacccggcggtgtcgtcctggtggagccgtggtggttcccggagtcgttcctggagggg
tacgtggccggccacgcactcactcgcgacggccgcaccatcacccgcgtctcgcactcc
acccggcagggcgacatggtgcgcatggagctccactacgtcctggcggacgccggcggc
gtggagcaccgcagcgaagtcgacatgctgacgctgttcacccgcgagcagtacgaggag
gccttctcccgggccggagtgaaggcggagtacgcgaagtccgaggggacggggccgggc
ttcttcgtgggcgtgcgcggctga

DBGET integrated database retrieval system