KEGG   Streptomyces rubrolavendulae: A4G23_00555
Entry
A4G23_00555       CDS       T04616                                 
Symbol
tfdB
Name
(GenBank) 2,4-dichlorophenol 6-monooxygenase
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00404  Staurosporine biosynthesis
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
Module
srn_M00805  Staurosporine biosynthesis, tryptophan => staurosporine
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    A4G23_00555 (tfdB)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-
     A4G23_00555 (tfdB)
SSDB
Motif
Pfam: FAD_binding_3 DAO Lycopene_cycl Pyr_redox_2 FAD_binding_2 NAD_binding_8 Pyr_redox Pyr_redox_3 HI0933_like
Other DBs
NCBI-ProteinID: AOT57765
UniProt: A0A1D8FX75
Position
complement(659652..661289)
AA seq 545 aa
MTRSAEWTDVLIVGGGPVGLALALDLAYRGIDCTVAEAGDGTVRHPKVSTIGPRSMELLR
RWGVADAVRGAGWPSDHPLDIAWVTRVGGHEIYRYRRGTAGSRPAFAHTPEPDQMCPAHW
LNPVLTRAVGVHPDGPLRLRTTVERVRQADDHVEAALTDHSTGTTRTLRARYVVACDGAA
SPVRRACGIDAPARHRTQVFRNILFRAPELRERLGDRAALVHFLMLSATLRFPLRALNGT
DLYNLVVGVEDEAAGRADAAALVREALAFDTPVELLGDGEWRLTHRVADRYRAGRVFLAG
DAAHTLSPSGGFGLNTGIGDAADLGWKLAAALDGWAGRHLLDTYETERRPIAVESLEEAN
RNLRRTMSRRLPPGIAADGPEGERARAEVARRLEESGAWREFDAPEIHFGLGYRSPAIVE
DPAAPARPGKPDARWRPGSDPGYRAAHAWWDATTSTLDLFGRGYVLLCFAEDGEPAVVER
AFAERGVPLTVRSGGAEEVAKLYERSFVLVRPDGHVAWRGDALPRDAGALADIVRGERTQ
PVRDL
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgacacgttccgccgagtggaccgacgtactgatcgtgggcggcggcccggtcgggctg
gcgctcgccctcgacctggcgtaccgcgggatcgactgcacggtcgccgaggccggcgac
gggacggtccggcatcccaaggtcagcacgatcggcccccggtcgatggagctgctgcgc
cgctggggggtggccgacgccgtccgcggcgccggatggccgtccgaccaccccctggac
atcgcctgggtcaccagggtcggcggtcacgagatctaccgctaccgccggggcacggcc
ggaagccggccggccttcgcgcacacccccgagcccgaccagatgtgcccggcgcactgg
ctgaacccggtgctgacgcgcgccgtgggcgtgcaccccgacgggccgctgcggctccgc
acgaccgtcgaacgcgtgcggcaggccgacgaccacgtggaggccgccctcaccgaccac
tccaccggcaccacccgcaccctgcgggcccggtacgtggtggcctgcgacggcgccgcg
tcccccgtccggcgggcctgcggcatcgacgcgccggcgcgccaccgcacgcaggtcttc
cgcaacatcctcttccgcgcccccgagctgagggagcgcctcggcgaccgcgccgccctc
gtccacttcctgatgctctccgccacactgcgcttccccctgcgcgcgctgaacggcacc
gacctgtacaacctggtcgtgggcgtcgaggacgaggccgccgggcgcgccgacgcggcc
gccctggtccgcgaggccctggcgttcgacaccccggtggagctgctgggcgacggggag
tggcgcctcacccaccgcgtggccgaccgctaccgcgccgggcgggtcttcctcgccggg
gacgccgcgcacaccctctcgccgtccgggggcttcgggctcaacaccgggatcggcgac
gccgccgacctgggctggaagctcgccgcggcgctggacggctgggcggggcgccatctg
ctcgacacgtacgagaccgagcgccggccgatcgccgtggagagcctggaggaggccaac
cgcaacctgcggcggaccatgagccgccggctgccgcccggcatcgcagcggacggcccc
gagggcgagcgcgcccgcgcggaggtggcgcggcggctggaggagagcggggcgtggcgg
gagttcgacgccccggagatccacttcgggctgggctaccgatccccggcgatcgtcgag
gacccggcggcgcccgcccgcccggggaagccggacgcgcggtggcgccccggcagcgac
cccggttaccgggccgcgcacgcctggtgggacgccaccacctccacgctggacctgttc
gggcgcggatacgtgctgctgtgcttcgccgaggacggcgaaccggcggtcgtcgagcgc
gcgttcgccgagcgcggggtgccgctgaccgtgcggagcgggggagcggaggaggtcgcc
aagctctacgagcggtccttcgtgctggtccgtccggacggccacgtggcgtggcggggc
gacgccctgccccgcgacgcgggggccctcgccgacatcgtgcggggggagcggacccag
cccgtgcgagacctctga

DBGET integrated database retrieval system