KEGG   Streptomyces rubrolavendulae: A4G23_05117
Entry
A4G23_05117       CDS       T04616                                 

Gene name
neoN
Definition
(GenBank) Neamine transaminase NeoN
  KO
K20567  neamine transaminase / neomycin C transaminase [EC:2.6.1.93 2.6.1.95]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00524  Neomycin, kanamycin and gentamicin biosynthesis
srn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A4G23_05117 (neoN)
Enzymes [BR:srn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.93  neamine transaminase
     A4G23_05117 (neoN)
    2.6.1.95  neomycin C transaminase
     A4G23_05117 (neoN)
SSDB
Motif
Pfam: Aminotran_3 BMC
Other DBs
NCBI-ProteinID: AOT62222
UniProt: A0A1D8G9U9
Position
complement(6035042..6036292)
AA seq 416 aa
MTKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVV
AEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATG
RPLLLSAGYHGYDPMWYPSEAPLEPNADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHM
HLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTAELLAPDVWVVAKGMANGHAVS
AVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKAL
DDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAAFDEAVLGEA
ERRFARVCERLAPYAGGEPVGDAARYRVAWNVMDGLRQAPRDREETTGLLARLLDD
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgacgaaaaactcttccctgctggccgaattccccacctgcccgcgcgacgagaaagac
cgcccgcgggttttcaccgccgcgtccggcgcctggctgacggacgagtccggtttccgc
tggatcgatttcgacaatgcgcgggggtcgattctgctggggcacggcgacccggtggtc
gccgaggccgtcgcgcgggcggcgaccggcgcggacggcaccgcgaccgggtggagccgg
cgggtcgacgcggtgctggagcggctgcacgccctgtgcggcggcgaggtcgtggggctc
ttccggtcgggtacggccgcggtccgggccgccgtgctggccgtgcgggaggcgacgggg
cggccgctgctgctgagcgccggctaccacggctacgacccgatgtggtacccgtccgag
gcgccgctggagcccaacgcggacggggtggtggacttcttcttcgacctcggcctgctg
cgggagctgcttcgggcccccgagcgggtcgccgccgtcgtcgtgtcgcccgaccacatg
cacctgtcgcccggctggtaccgcgagctgcgccggctgtgctcggcggccggggtggtg
ctggtcgcggacgaggtgaaggtgggactgcgctacgcaccgggcctgtccacggccgag
ctgctcgcgcccgacgtgtgggtggtcgccaagggcatggccaacgggcacgcggtctcc
gcggtcggcgggtcccgccggctgctgaagccgctgaaggaggtgtcgttcacctcgttc
ttcgagcccacgatcctggccgcggcggacgccgcgctcgcccgggtcgccaccggggag
ccgcagcgggcggtccgggaggccggggaccgcttcctgcgccacgcccgcaaggcgctg
gacgacgcgtccctgccggtcgagatcgccggcgacggcacgttcttccagttcgtaccg
gcgaccgaggagctggaggaggcgctctacggggcggcgaacgccgagggcctgctcttc
tacgcgggcgacaaccagggcgtgtcggccgccttcgacgaggccgtgctcggcgaggcc
gagcggcggttcgcccgcgtgtgcgaacggctggcgccgtacgcgggcggggagccggtc
ggcgacgcggcccgctaccgggtcgcctggaacgtgatggacggactgcggcaggccccg
cgcgaccgcgaggagaccaccggcctgctggcgcggctgctggacgactga

DBGET integrated database retrieval system