KEGG   Streptomyces rubrolavendulae: A4G23_05124
Entry
A4G23_05124       CDS       T04616                                 

Gene name
neoG
Definition
(GenBank) Paromamine 6'-oxidase
  KO
K20565  paromamine 6'-oxidase / 6'''-hydroxyneomycin C oxidase [EC:1.1.3.43 1.1.3.44]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00524  Neomycin, kanamycin and gentamicin biosynthesis
srn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A4G23_05124 (neoG)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.43  paromamine 6'-oxidase
     A4G23_05124 (neoG)
    1.1.3.44  6'''-hydroxyneomycin C oxidase
     A4G23_05124 (neoG)
SSDB
Motif
Pfam: GMC_oxred_C GMC_oxred_N FAD_binding_2 NAD_binding_8 FAD_binding_3 FAD_oxidored Pyr_redox_2 DAO HI0933_like GIDA Thi4 Lycopene_cycl Pyr_redox
Other DBs
NCBI-ProteinID: AOT62229
UniProt: A0A1D8G9V1
Position
complement(6042518..6044422)
AA seq 634 aa
MGASPACTGAGWPPRRRDAGRRAPGGTRPRPARREARRARAPDRAHAGGPRSVAPHGHSP
YDPYDTYDTYDTYDTYDPNDHDDHDDHDDERHRMKRLRGTLPSDARHAWHPEPLGPAHRD
GWDTRDDDRVWDVVVIGSGASGSVAADRLVRQGLDVLMIEEGFRLSPDLGNPELDDMCRT
ALARDGQGGWTDEGWPWTTSNLGGGTVFYGGASWRYRPFDFDPSELVDAGGLDVRWPYGL
AELAPYYDVLERRLGVCGGEEGEGSRGPAHPPTAAAEVLYEAGTALGYEPFPTPLAINRH
AHGGRSACERNSLCVSHQCSTGAKGDAVAVFLAPLASHPNFTLRTGVRALRLNQDRPDAV
GSVTCLDRLGRTTHRVRARSFVVACNAIQSAALLLRSRGGRAPDGVGNHSGLVGRGLTMK
LSEYVSGVVDAPSAATLADWRAHAGPFSTIAFLDHYLDADCPTGVGGMIYESKNDMPSRI
RDDVLELRIETILADHPNLDNRVRLSSHADEDGVPAVVIDYTPDPRDLRRLAYMTDVCER
LLRKAGATGIAHEESGFAQGSCHLHGTCRAGDDPATSVVDGWGRVHSAPNVYVVDGGFMP
YPGGLNPTLTIQAHALRSAKAVAGDLVSRHTAHV
NT seq 1905 nt   +upstreamnt  +downstreamnt
gtgggcgcttcgccggcatgcaccggggctggctggccgccacgacggcgtgacgcgggc
cgccgcgcgccgggcgggacacgcccgcgccccgcacgccgcgaggcgcgccgggcccgc
gctccggaccgggcgcacgccgggggcccgcgctccgtcgccccgcacgggcactccccc
tacgacccctacgacacctacgacacctacgacacctacgacacctacgaccccaacgac
cacgacgaccacgacgaccacgacgacgaaaggcacaggatgaagcgccttcgaggcacc
ctgccctcggacgcacggcacgcgtggcacccggagccgctgggtcccgcgcaccgcgac
ggctgggacacccgtgacgacgaccgggtctgggacgtcgtcgtgatcggcagcggcgcc
agcggctccgtcgccgcggaccggctcgtccggcagggcctggacgtcctgatgatcgag
gagggcttccggctctcccccgacctcggcaaccccgagctggacgacatgtgccgcacg
gcgctggcccgtgacggccagggcggctggaccgacgagggctggccgtggacgacgtcc
aacctcggcggcggcacggtcttctacggcggcgcctcctggcgctaccggccgttcgac
ttcgacccgagcgagctggtggacgcgggcgggctcgacgtccgctggccgtacgggctg
gccgaactcgcgccgtactacgacgtgctggaacgccggctgggggtgtgcggcggcgag
gagggcgagggcagccgcggccccgcgcaccccccgacggccgcggccgaggtgctttac
gaggcgggcaccgcactcggctacgagcccttccccaccccgctggccatcaaccggcac
gcccacggcgggcgttcggcgtgcgagcgcaactcgctgtgcgtgagccaccagtgctcg
acgggcgccaagggcgacgcggtcgcggtcttcctcgcaccgctcgcctcgcaccccaac
ttcaccctgcgcaccggtgtacgggccctgcgcctgaaccaggaccggccggacgccgtc
ggttcggtgacctgcctggaccggctcggccgcaccacgcaccgcgtccgcgcccggtcg
ttcgtcgtcgcgtgcaacgcgatccagagcgccgcgctgctgctgcgctcccgcggcggg
cgcgccccggacggcgtggggaaccactccggcctggtcgggcgcggcctgacgatgaag
ctgagcgagtacgtgagcggtgtggtcgacgcgccgtccgccgcgacgctcgccgactgg
cgcgcgcacgcgggcccgttctccacgatcgcgttcctcgaccactacctggacgccgac
tgccccaccggggtcggcgggatgatctacgagtcgaagaacgacatgccctcgcgcatc
cgcgacgacgtgctggaactgcgcatcgagacgatcctggccgaccacccgaacctcgac
aaccgggtgcggctctcctcgcacgccgacgaggacggcgtgccggccgtggtcatcgac
tacacgcccgacccccgcgacctgcgccgcctcgcgtacatgacggacgtgtgcgagcgg
ctgctgcggaaggccggcgcgaccgggatcgcgcacgaggagagcggcttcgcccagggg
agctgccacctgcacggcacgtgccgggccggcgacgacccggcgacgtcggtggtcgac
ggctggggccgggtccactcggcgcccaacgtgtacgtcgtcgacggcggcttcatgccg
tacccgggcggcctgaaccccacgctcaccatccaggcgcacgcgctgcgcagcgccaag
gccgtcgccggcgacctcgtgtcccggcacaccgcgcacgtctga

DBGET integrated database retrieval system