KEGG   Streptomyces rubrolavendulae: A4G23_05129
Entry
A4G23_05129       CDS       T04616                                 
Symbol
neoB
Name
(GenBank) L-glutamine:2-deoxy-scyllo-inosose aminotransferase
  KO
K13547  L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase [EC:2.6.1.100 2.6.1.101]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00524  Neomycin, kanamycin and gentamicin biosynthesis
srn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A4G23_05129 (neoB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srn01007]
    A4G23_05129 (neoB)
Enzymes [BR:srn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.100  L-glutamine:2-deoxy-scyllo-inosose aminotransferase
     A4G23_05129 (neoB)
    2.6.1.101  L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase
     A4G23_05129 (neoB)
Amino acid related enzymes [BR:srn01007]
 Aminotransferase (transaminase)
  Others
   A4G23_05129 (neoB)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AOT62234
UniProt: A0A1D8G9W1
Position
complement(6051041..6052315)
AA seq 424 aa
MVSPLAVKGGEALRTRPWPAWPQPAPGVPAAVAEVLGSGRWSISGPYRGTDSHERRFARA
FADYHGVPYCVPAASGTAGLMLALEACGVGAGDEVIVPGLSWVASGSTVLGVNAVPVFCD
VDPDTLCVSPEAVEALITERTRAIVVVHLYSAVADMDGLTRVAERHGLPLVEDCAQAHGA
SYRGVKVGALATAGTFSMQHSKVLTSGEGGAVITRDADLARRVEHLRADGRCLSDGPPAP
GAMELVETGELMGSNRCLSEFQAAILTEQLTLLDEQNRTRRANAARLDGLLGELGLRPQA
TSEGTTSRTYYTYAARLPEGALEDVPLTDVTGALTAELGFPVQPCYAPIPANRLYAPQTR
RRYTLGPDHEARIDPKRFALPVCEDTARRTVTLHHAALLGDAEDMADIAAAFAKVLRHGA
DLAT
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggtctccccgttggcagtgaagggcggcgaggcgttacgcacccgcccctggcccgcc
tggccgcagcccgcccccggagtccccgccgcggtggcggaggtgctcggctcgggccgg
tggtccatcagcggcccgtaccgcggcacggactcccacgagcggcgcttcgcgcgggcg
ttcgccgactaccacggcgtgccgtactgcgtccccgccgcgagcggcaccgccggcctg
atgctggccctggaggcgtgcggggtcggcgccggcgacgaggtgatcgtccccggcctg
tcctgggtcgcctccggctccaccgtcctgggcgtcaacgccgtcccggtcttctgcgac
gtcgacccggacacgctgtgcgtctcccccgaggccgtcgaagcgctgatcaccgagcgg
accagggccatcgtggtggtccacctctactcggccgtcgcggacatggacggcctcacc
cgcgtcgccgagcgccacggcctgcccctcgtcgaggactgcgcccaggcccacggggcc
tcctaccggggcgtcaaggtcggtgcgctggccaccgccggcaccttcagcatgcagcac
agcaaggtgctcaccagcggcgagggcggcgcggtcatcacccgcgacgcggacctcgcc
cgccgggtcgagcacctgcgggccgacggccgctgcctgtccgacggcccgcccgcgccg
ggcgccatggagctggtcgagaccggcgagctgatgggcagcaaccgctgcctgtccgag
ttccaggccgccatcctcaccgagcagctcaccctgctcgacgagcagaaccgcacccgc
cgcgccaacgccgcccgcctcgacggcctcctcggcgagctgggcctgcgcccccaggcg
acctccgagggcaccacctcccgtacgtactacacctacgcggcgcggctccccgagggc
gcgctggaggacgtcccgctcaccgacgtcaccggcgccctcaccgccgagctcggcttc
cccgtccagccctgctacgccccgatcccggcgaaccggctgtacgccccgcagacccgc
aggcgctacacgctcggcccggaccacgaggcgcgcatcgaccccaagcgcttcgccctc
ccggtgtgcgaggacaccgcgcggcggaccgtcaccctgcaccacgccgccctgctcggc
gacgccgaggacatggccgacatcgccgcggccttcgcgaaggtcctgcggcacggcgcc
gacctggccacttga

DBGET integrated database retrieval system