Serratia sp. AS12: SerAS12_1411 Help Entry SerAS12_1411      CDS       T01502                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism srs  Serratia sp. AS12 Brite KEGG Orthology (KO) [BR:srs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:srs03400]     SerAS12_1411 Enzymes [BR:srs01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      SerAS12_1411 DNA repair and recombination proteins [BR:srs03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     SerAS12_1411  Prokaryotic type     SerAS12_1411 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Tannase Motif Other DBs NCBI-ProteinID:  AEF49499 Position 1528700..1529116 Genome browser AA seq 138 aa AA seqDB search MDNNSFGGAKIALLCGDSLLTYRRDDKIGIPWPGCWDLPGGGREGDETPLQCVQRETFEE FGLHITARQVNWQQRYDGILAGYPPTWFMVGEITQAQIAAIRFGDEGQCWQMMAIDRFIT HPQGISHLQQRLAAYLRR NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggacaacaacagcttcggcggcgccaaaatcgcgctgctgtgcggcgatagcctgctg acctatcggcgtgatgacaaaatcggcatcccctggcccggctgctgggatctgcccggc ggcgggcgtgaaggcgatgaaacgccgttgcaatgcgtgcaacgcgaaaccttcgaggaa tttggcctgcacattaccgctcggcaggtgaactggcaacagcgctatgatggtattctg gccggctatccgcccacctggtttatggtgggcgaaatcacccaggctcaaattgccgcc atccgctttggcgatgaggggcaatgctggcagatgatggctatcgaccgctttatcacc catccgcagggcatttcgcatctgcagcagcggctggcggcgtatctgcgccgctag

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (3) Pfam (3) All databases (5) Download RDF

DBGET integrated database retrieval system