KEGG   Streptomyces solisilvae: I1A49_09865
Entry
I1A49_09865       CDS       T07406                                 

Name
(GenBank) hypothetical protein
  KO
K18240  chorismate lyase / 3-hydroxybenzoate synthase [EC:4.1.3.40 4.1.3.45]
Organism
ssoi  Streptomyces solisilvae
Pathway
ssoi00130  Ubiquinone and other terpenoid-quinone biosynthesis
ssoi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssoi01100  Metabolic pathways
ssoi01110  Biosynthesis of secondary metabolites
ssoi01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ssoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    I1A49_09865
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    I1A49_09865
Enzymes [BR:ssoi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     I1A49_09865
    4.1.3.45  3-hydroxybenzoate synthase
     I1A49_09865
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: QPI55202
UniProt: A0A7S9UU42
Position
complement(2547991..2548983)
AA seq 330 aa
MTSYFENGRAGGVPPAGRNILGVVNYASVCEYPTLDHGYPELEINMVAPTAEPFAEVWVT
DAEAEHGERDGITYAHDGEYFFCAGRVPPTGRYTEATRAAYVTMFELLEEFGYSSVFRMW
NFIGDINRDNAEGMEVYRDFCRGRAEAFEQCRLEFDQFPAATGIGSRGGGIAFYLLACRS
GGHVHIENPRQVPAYHYPKRYGPRAPRFARATYLPSRAADGGGGQVFVSGTASVLGHETA
HEGDLVKQCRLALENIELVISGGNLAAHGISAGHGLMALRNIKVYVRRAEDVPAVREICR
EAFSPDADIVYLTVDVCRSDLLVEIEGVVM
NT seq 993 nt   +upstreamnt  +downstreamnt
ttgacgtcgtacttcgaaaacgggcgcgccgggggagtgcccccggccggaagaaacatc
ctcggggtcgtcaactacgcgtccgtgtgcgaatacccgacccttgaccacggctatccc
gaactcgaaatcaacatggtcgccccgaccgcggagcccttcgccgaggtatgggtgacg
gacgccgaagcggagcacggcgaacgcgacggaatcacctacgcgcacgacggcgagtac
ttcttctgtgccggtcgtgtgccacccaccgggcggtacacggaagccaccagagcggcg
tacgtcaccatgttcgagctgctggaggaattcggctactccagcgtgttccgcatgtgg
aacttcatcggtgacatcaatcgcgacaacgcggagggcatggaggtctaccgcgacttc
tgccgcggccgggccgaggcgttcgagcagtgccggctggaattcgaccagttcccggcg
gccaccgggatcggctcccggggcggcgggatcgccttctacctgctggcctgccggtcc
ggcgggcatgtgcacatcgagaacccccggcaggtgccggcctaccactacccgaagcgg
tacggcccgcgtgcgccgcgcttcgcccgcgccacctacctgccgtccagggccgcggac
gggggcggcggccaggtcttcgtgtccggcaccgccagcgtgctcggccatgagacggcg
cacgagggcgacctggtcaagcagtgccgactggcgctggagaacatcgaactcgtcatc
agcggcgggaacctggccgcgcacggcatatccgccggccacgggctaatggcgctgcgc
aatatcaaggtgtacgtccgcagggccgaggatgtgcccgcggtgcgcgagatctgccgg
gaggcgttctcaccggacgccgatatcgtgtatctgacggtggacgtctgccgttccgat
ctgctggtggagatcgagggcgtggtcatgtag

DBGET integrated database retrieval system