KEGG   Streptomyces solisilvae: I1A49_45310
Entry
I1A49_45310       CDS       T07406                                 

Name
(GenBank) hypothetical protein
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
ssoi  Streptomyces solisilvae
Pathway
ssoi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    I1A49_45310
Enzymes [BR:ssoi01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     I1A49_45310
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: QPI61180
UniProt: A0A7S9YKF7
Position
complement(11183251..11184363)
AA seq 370 aa
MIPLNRPAIIGARSRGLRGVARTYFAVLVRTPGPRRRSRRSATPHCSFEKIASPDLADDE
TVLGVIEHRTGHSGVALIDGRPHTAVHTTTDESESFAEVWRVDGPKESGSHGGIAWARTA
DYLFGVARVPEGDRYADGTAAVYTGIFDLIGELGHPRLARTWNYVSGINTLNADGMEVYR
DFCVGRAEALDARGVEPAGMPAATGIGTHGGGIACYFLAARAGERVNLENPAVLTAHRYP
RQYGPRPPIFARATWLAPPGSDDGRLYVSATAGIRGHETVHHGDVARQCDVALENIAQVI
SAENLRRHGLRRGYTLADVDHLKVYVRHREDVRAVRRICAERFSREATVAVLHTDIARTD
LLVEIEGVVA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgatccccctgaatcgcccggcgattatcggcgcccgttctagggggttgcggggagtg
gcgcgcacatatttcgctgtgctggtgcgtaccccaggaccgcgaaggcggtcgagacga
tcagccacgccgcactgctccttcgagaagatcgcgtcgcccgacctcgccgacgacgag
acggtgctcggcgtcatcgaacaccgcaccgggcacagcggggtggccctgatcgacggc
cgcccgcacaccgcggtgcacacgaccaccgacgagagcgagtcgttcgccgaggtgtgg
cgggtggacggtccgaaggagtcgggcagccacggcggcatcgcctgggcccggacggcc
gactatctcttcggcgtcgcccgggttccggagggagaccggtacgcggacggcaccgcg
gccgtctacaccgggatcttcgacctgatcggcgagctgggacacccccggctggcccgg
acctggaactacgtcagcggcatcaacacgctgaacgccgacggcatggaggtctaccgc
gacttctgtgtgggccgcgccgaagcgctggacgcccgcggggtcgaaccggccggcatg
ccggcggcaaccggcatcggcacccacggcggcggcatcgcgtgctacttcctcgccgcc
cgcgccggtgagcgggtcaacctggagaaccccgccgtgctgacggctcatcgctaccca
cggcagtacggcccccgcccgccgatcttcgcccgcgccacctggctcgcgccgcccgga
tcggacgacggccggctctacgtctcggcgaccgccggcatccgcggccacgagaccgtg
caccacggggacgtcgcccggcagtgcgacgtggcgctggagaacatcgcccaggtgatc
agtgccgagaacctgcggcggcacgggcttcggcgggggtacacgctggccgacgtcgac
catctgaaggtctacgtacgacaccgcgaggacgtacgggccgtacgccggatctgcgcc
gagcggttttcccgcgaggccacagtggccgtgctgcacaccgacatcgcacgcaccgac
ctcctggtcgagatcgagggagtggtggcgtga

DBGET integrated database retrieval system