KEGG   Salvia splendens (scarlet sage): 121782908
Entry
121782908         CDS       T07627                                 
Name
(RefSeq) pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 4'''-malonyltransferase
  KO
K12935  anthocyanin 5-O-glucoside-4'''-O-malonyltransferase [EC:2.3.1.214]
Organism
sspl  Salvia splendens (scarlet sage)
Pathway
sspl00942  Anthocyanin biosynthesis
sspl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sspl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00942 Anthocyanin biosynthesis
    121782908
Enzymes [BR:sspl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.214  pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 4'''-malonyltransferase
     121782908
SSDB
Motif
Pfam: Transferase Calsequestrin
Other DBs
NCBI-GeneID: 121782908
NCBI-ProteinID: XP_042036839
Position
20:complement(869165..871148)
AA seq 417 aa
MNINQINTKLIKPITPTPQNLKNYHISFLDQHVVKKYIAVVLYYQSAPDNGRLEDSLAET
LVHFYPLAGRYIKTDLTVDCSDQGAEFIEAEARGDVRVTDLIGKTDTIHLCPEQYFGLDE
GVDDPLLSIQVTRFSCGGATIAVSVSHRVFDVSSLETFLSAWSSASKTGGGVAPVIPSFA
LASLLPNKDEKFGLDSNKCQGKEQKIAVKRLLFEKRALTRLTSERTSGVRAACAVIAKAL
IRLDRTTHGKSRDFVVFQPINMRGRTGVPSPKNACGNMSFGSFTRRVSAKEEVGIGELVG
LIGDGVRRGIAEYTEILCPDRDGRDVIIHVRNKNIKEVFKSETFVVSFTDWSKFGFYEVD
FGWGRPIWSGVGPQRPRGNQTIMMRSKEGDGIEAWVHLNEDDMDLFEQDVEIKLFMS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaatatcaaccaaatcaacaccaagttgatcaaaccaataaccccaactccccaaaac
ctcaagaactaccacatttccttcctagatcagcatgttgtgaagaagtacattgccgtt
gttctctactaccaatcggcccccgacaacggccggttggaagactcgctcgccgaaacc
ctagtccacttctaccctctcgccggaagatacatcaagaccgatctcacggtggattgc
agcgaccaaggcgccgagtttatcgaagcagaggcacgaggcgacgttcgagtcacggat
cttatcgggaagaccgacaccatccacctctgtccagagcaatactttggtctggacgaa
ggtgttgatgatccgctcctctcgatccaggtcacgcgtttctcgtgtggcggggccacc
atcgcagtcagcgtttcacatagggttttcgacgtgtcatctctggagacattcctttct
gcgtggtcgagcgctagtaaaacgggtggaggagtcgccccggtcatcccatctttcgcg
ctcgcctcgttgcttccaaacaaggacgaaaaattcgggctggattccaacaagtgtcaa
ggaaaggagcaaaagattgctgtgaagcggcttttgttcgaaaaaagggccttgacgagg
ctcacgagtgagagaacgtctggcgtccgtgctgcttgtgccgtcatagcaaaagccctg
atccgtcttgaccggacgacacatggaaaaagcagagacttcgtcgtgtttcagccaatc
aacatgcgggggagaaccggcgttccgtctcctaaaaacgcctgtgggaacatgtcgttt
ggctcgttcacgcggcgcgtttctgctaaggaggaggtcgggataggggagctcgtgggc
ctgatcggggacggtgtgcggaggggcattgcggaatacacggagatactgtgcccggat
cgagacgggcgcgatgtcatcatacatgtacgcaacaagaatataaaagaggtgtttaaa
tctgagacctttgtggtttctttcacagattggagcaagtttggattctatgaagtggat
tttgggtgggggaggcccatttggagcggcgttgggccgcagcggccgcgtgggaaccag
actataatgatgagaagcaaagagggagatgggattgaggcgtgggtgcacttgaatgag
gatgacatggatttgtttgagcaagatgtggagatcaagttatttatgtcgtaa

DBGET integrated database retrieval system