KEGG   Streptomyces spongiicola: DDQ41_30655
Entry
DDQ41_30655       CDS       T06937                                 
Name
(GenBank) FAD-binding monooxygenase
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Organism
sspo  Streptomyces spongiicola
Pathway
sspo00404  Staurosporine biosynthesis
sspo01100  Metabolic pathways
sspo01110  Biosynthesis of secondary metabolites
Module
sspo_M00805  Staurosporine biosynthesis, tryptophan => staurosporine
Brite
KEGG Orthology (KO) [BR:sspo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    DDQ41_30655
Enzymes [BR:sspo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-
     DDQ41_30655
SSDB
Motif
Pfam: FAD_binding_3 DAO FAD_binding_2 Lycopene_cycl Pyr_redox_2 Pyr_redox_3 NAD_binding_8 HI0933_like Pyr_redox
Other DBs
NCBI-ProteinID: AWK12556
UniProt: A0A2S1Z866
Position
complement(7059057..7060697)
AA seq 546 aa
MTYSGERTDVLVVGGGPVGMAVALDLTYRGIDCMVVDAGDGQVRHPKVSTIGPRSMELFR
RWGVADAVRGAGWPADHPLDIAWVTRVGGHEVYRYRRGTAASRPAFVHTPEPDQICPAHW
LSPVLSRALGVHPAGPLRLLTTVDRVLPADDHVEAVLTDRATGRTGTVRARFLVACDGAS
SPIRRACGIEAPGRHRTQVFRNVLFRAPELRERLGDRAALVYFLMLSSTLRFPMRSLNGG
DLYNLVVGADGDRGARADALSLIHDALAFDTPVEVLGDSEWHLTHRVADRYRAGRVLLAG
DAAHTLSPSGGFGLNTGIADAADLGWKLAATLNGWAGRHLLDTYDTERRPIALESLNEAN
TNLQRTMSRELPPGIHLDGPEGERARTEMAGRLASSGARREFDAPQIHFGLRYRSPAIVD
DPGVPIRQGRPDADWRPGSEPGHRAAHAWWEASTSTLDLFGQGFVLLRFADHDGLPAFER
AFAERGVPLTVHRGGDPEIAKLYERSFVLVRPDGHVAWRGDDLPGDPVALVDTVRGDRGE
AASGEG
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgacgtactccggcgagcggaccgacgtgctggtcgtgggcggcggcccggtcgggatg
gcggtggcactggacctgacgtaccgcgggatcgactgcatggtcgtcgacgccggtgac
ggacaggtccggcatcccaaggtcagcacgatcggtccgcgctcgatggaactgttccgc
cgctggggcgtcgcggacgccgtccggggggcgggctggcccgccgaccaccctctggac
atcgcctgggtcaccagggtgggcggtcacgaggtgtaccggtaccgccgcggcaccgcc
gcgagccggccggccttcgtgcacactcccgagcccgaccagatctgtcccgcacactgg
ctgagcccggtgctgtcgcgggcgctgggcgtccacccggccggcccgctgcggctcctc
accaccgtcgaccgcgtactgccggccgatgaccacgtcgaagccgtcctgaccgaccgg
gccacgggcaggaccggcaccgtccgggcacgcttcctggtcgcctgcgacggcgcctct
tctcccatccgccgggcctgcggcatcgaggcgccgggccgccaccgcacacaggtcttc
cgcaacgtcctcttccgggcccccgaactcagggaacggctgggcgaccgcgccgccctc
gtgtacttcctgatgctgtcgtccacgctgcgcttccccatgcgctcgctgaacggcggc
gacctctacaacctggtcgtgggcgcggacggcgaccgcggggcgcgtgccgacgcgctg
tccctgatccacgatgccctcgccttcgacacgccggtggaagtgctcggcgacagcgag
tggcacctcacccaccgggtcgccgaccggtaccgggccgggcgcgtcctcctcgccggc
gacgcggcgcacaccctgtcgccctcgggcggcttcgggctcaacaccggcatcgcggac
gccgccgacctgggctggaaactcgccgccacactgaacggctgggcgggtcggcacctg
ctcgacacctacgacaccgagcgcaggccgatcgccctggagagcctcaacgaggccaac
accaacctgcaacgcaccatgagcagggaactgccgcccgggatccacctggacgggccc
gagggcgagcgggcccgcaccgagatggcggggcggctggcgagcagcggcgcgcggcgg
gagttcgacgccccgcagatccacttcggactgcgctaccgctccccggcgatcgtcgac
gaccccggcgtaccgatccgccaaggccggccagacgccgactggcggcccggcagcgag
cccggccaccgcgccgcgcacgcgtggtgggaagcctccacctccacgctcgacctgttc
ggccagggcttcgtactgctccgcttcgcggaccacgacggccttccggcgttcgagcgc
gcgttcgccgagcggggggtcccgctgaccgtgcaccggggcggcgacccggagatcgcc
aagctgtacgagcgctccttcgtgctggtacgccccgacggccacgtggcatggcgcggc
gacgacctcccgggggacccggtggccctcgtcgacacggtccggggcgaccggggcgag
gcggcgtccggcgaggggtga

DBGET integrated database retrieval system