KEGG   Streptomyces tirandamycinicus: DDW44_27830
Entry
DDW44_27830       CDS       T06843                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
stir  Streptomyces tirandamycinicus
Pathway
stir00523  Polyketide sugar unit biosynthesis
stir01100  Metabolic pathways
stir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stir00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DDW44_27830
Enzymes [BR:stir01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     DDW44_27830
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 NodS Methyltransf_12 NNMT_PNMT_TEMT
Other DBs
NCBI-ProteinID: AWI32185
UniProt: A0A2S1T0K2
Position
complement(6390698..6391426)
AA seq 242 aa
MYSTDLAEVYETVYRSRGKDWAAEAEDIAALARRHAPDADALLDVACGTAAHLGPFSKLF
GTAEGLEIAAPMRDLALERWPGLTIHEGDMRDFDLGRRYSVVTCMFCAIGYLGSVEEMRS
AVASMARHLDPGGVLVVEPWWFPEQFTEGFVAGDLAREGDRTVARVSHSTLQGRATRMEV
RFLVGEPSGIRTFTEIDVLTLFTREEYEQAFRDAGCSVSYRPGPPTGRGLFVGTKEREVS
GR
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtacagcacggacctcgccgaggtgtacgagacggtgtaccgcagccggggcaaggac
tgggcggcggaggccgaggacatcgcggccctggcccgccggcacgccccggacgcggac
gcgctgctcgatgtggcgtgcggcaccgccgcccatctcggccccttcagcaagctcttc
ggcaccgcggagggcctggagatcgcggcgccgatgcgggacctggcgctcgagcggtgg
cccggcctgaccatccacgagggcgacatgcgcgacttcgacctcggccgccggtactcc
gtcgtcacctgcatgttctgcgccatcggctacctgggcagcgtcgaggagatgcgctcg
gccgtggcctcgatggcccgccacctcgacccgggaggcgtactggtcgtcgaaccctgg
tggttccccgagcagttcacggaggggttcgtcgccggggacctggcccgggagggcgac
cggaccgtcgcccgtgtctcccactccaccctgcagggccgggcgacgcggatggaggtc
cgcttcctcgtcggggagccgtcgggcatccggaccttcaccgagatcgacgtcctgacc
ctgttcacgcgtgaggagtacgagcaggcgttccgggacgccggatgctccgtcagctac
cggccgggcccaccgacgggccgcggcctcttcgtcggaaccaaggagcgggaggtgtcc
gggcgatga

DBGET integrated database retrieval system