Streptococcus troglodytae: SRT_06590 Help Entry SRT_06590         CDS       T06912                                  Symbol mutX Name (GenBank) mutator protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism strg  Streptococcus troglodytae Brite KEGG Orthology (KO) [BR:strg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:strg03400]     SRT_06590 (mutX) Enzymes [BR:strg01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      SRT_06590 (mutX) DNA repair and recombination proteins [BR:strg03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     SRT_06590 (mutX)  Prokaryotic type     SRT_06590 (mutX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Motif Other DBs NCBI-ProteinID:  BAQ23920 UniProt:  A0A1L7LIG5 Position 663105..663467 Genome browser AA seq 120 aa AA seqDB search MERGESPDECARREIFEETHLIVKQMDFKGIITFPDFTPDHDWYTYVFKVRDFEGQLISD KDSREGTLEWVPYDQVLTKPTWEGDYDIFKWILEDAPFFSAKFVYQEQKLVDKHVIFYEK NT seq 363 nt NT seq  +upstreamnt  +downstreamnt ttggaaaggggagaaagtcctgatgaatgtgccagacgtgagatttttgaggaaactcat ctaattgtcaaacaaatggattttaaaggtattattacttttccagattttacaccagat catgattggtatacctatgtgtttaaggtaagagattttgaaggccagttgatttctgat aaagacagtcgtgagggaacgctggaatgggtaccttatgatcaggttttaactaagccg acatgggaaggcgactatgacatttttaaatggatcttagaagacgccccttttttctct gccaaatttgtttatcaagagcaaaagctagttgataaacatgtgattttttatgaaaaa tag

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (1) Pfam (1) All databases (3) Download RDF

DBGET integrated database retrieval system