KEGG   Streptococcus troglodytae: SRT_19150
Entry
SRT_19150         CDS       T06912                                 

Name
(GenBank) beta-D-fructosyltransferase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
strg  Streptococcus troglodytae
Pathway
strg00500  Starch and sucrose metabolism
strg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SRT_19150
Enzymes [BR:strg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     SRT_19150
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig DUF4305
Other DBs
NCBI-ProteinID: BAQ25176
UniProt: A0A1L7LLY7
Position
complement(1918780..1921194)
AA seq 804 aa
MENKVRKKMYKKGKFWVVATVTTVMLTGISLSSVHADEVSSTQSSSELIEGNQTQESKIT
TSSAAENQVQSDVQASHSVQETSATDTVAAIEDSTQTAAVVTANNADKAEEGKSQGQVST
AAASDKTSASTSEVGQTNDKAKASKEITATTPENTVDEYGLTEQAHKIATEAGVDLSSLT
QRQIEALNKVKLTSDAQTGHQMTYQEFDKIAQTLIAQDERYAIPYFNAKAIKNMKAATTR
DAQTGQIADLDVWDSWPVQDAKTGEVINWNGYQLVVAMMGIPNTNDNHIYLLYNKYGDNN
FDHWKNAGSIFGYNETPLTQEWSGSATVNEDGSLQLFYTKVDTSDQNSNNQRLATATVNL
GFDDQDVRILSVENDKVLTPEGGDGYHYQSYQQWRSTFTGADNIAMRDPHVIEDEKGDRY
LVFEASTGTENYQGEDQIYNFTNYGGSSAYNVKSLFRFLDDQDMYNRASWANAAIGILKL
KGDKKTPEVDQFYTPLLSSTMVSDELERPNVVKLGDKYYLFTASRLNHGSNNDAWNKANE
VVGDNVVMLGYVSDQLTNGYKPLNNSGVVLTASVPADWRTATYSYYAVPVTGSSDTLLMT
AYMTNRNEVAGKGKNSTWAPSFLIQVLPDGTTKVLAEMTQQGDWIWDESSRTTDTVGTLD
TAYLPGENDGYIDWNVIGGYGLKPHTPGQYQPTVPSTPNHVDDVISFEVSFDGHLVIKSV
KVNNNDSAGQNGQSGNSNGSLNVSFNVSAGGNISVKSTQKSINKTKETKKAHHVSTKKKQ
KKGNSFFTALLALFSAFCVSIGFK
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggaaaataaagttagaaaaaagatgtataagaaagggaagttttgggttgttgctact
gtcacaacagttatgctgactggaattagtctttcttcagttcatgcggatgaagtcagt
tcgacgcaatcttcttctgaattgattgagggcaatcaaactcaagaaagtaaaatcact
acttcatcggcagcagaaaaccaggttcagagtgacgtccaagcaagtcattctgttcag
gagacatcagcaacagatacagttgcagcaattgaagatagcactcaaacggctgcagtt
gtaacagctaacaatgctgacaaagcagaagaaggtaaatctcaaggacaggtgtctaca
gccgctgcctctgataagacatcggctagtacatcggaagtaggtcaaacaaatgacaaa
gccaaagcaagtaaagaaatcactgcgactacaccagagaacacagtagatgaatacggt
ctgacagaacaagcccataaaattgcgactgaagctggtgttgatttaagtagtttgacg
caacggcaaattgaagccctcaataaagttaaattaacgagtgatgctcaaaccggtcat
caaatgacttaccaagagtttgacaagatagctcaaacgttgatagctcaagatgaacgc
tatgctatcccttattttaatgcaaaagcgataaaaaacatgaaagcagctacaacacgt
gatgcccaaacgggtcaaatagctgatttggatgtttgggattcttggccagttcaggat
gctaagactggtgaggtcattaattggaatggttatcagcttgttgtcgctatgatgggg
attccaaatactaatgataatcacatttatcttctttacaataaatatggggataataac
tttgatcattggaaaaatgcaggttctatctttggttataatgaaacacccctaactcaa
gaatggtcaggttcagctaccgtaaatgaagatggaagtttgcagctattctacaccaag
gttgatactagtgatcaaaatagtaataatcaacgtttagcaacagcgactgtaaacctt
ggctttgatgaccaagatgttagaattctgtctgttgaaaatgataaagttttgacgcct
gaaggtggagatggctatcattatcaaagttatcaacaatggcgttcaacctttacaggg
gctgataacattgctatgcgtgatccacatgtcattgaagatgagaagggagatcgctat
cttgtctttgaggcaagcacaggtacagagaactatcaaggtgaagatcagatttacaac
tttactaactatggcggcagctctgcttataatgttaaaagtctttttagatttttagat
gatcaagatatgtataaccgtgcaagttgggccaatgcagctattggcattttaaaactt
aagggtgataaaaaaacacctgaggtagatcaattttacacgcctttactaagttcaaca
atggtttcggatgaactcgaacgaccaaatgtggttaaattaggagataagtactatctt
tttacagcttcacgtcttaatcacggaagtaacaacgatgcttggaataaagcaaatgaa
gttgttggtgataatgtcgttatgctaggttatgtttctgatcaattgactaacggctac
aaacccttaaataatagtggtgtggttttaacagcttcagttccagcagattggcgaacg
gcgacttactcttattatgctgttccagtaactggatcatctgataccctgttaatgacg
gcttatatgaccaatcgtaatgaagtcgcaggtaaaggtaagaattcaacctgggcacct
agtttcctcattcaggtcttgccagatggaacgacaaaagttttagcagaaatgacgcaa
caaggagattggatttgggatgaatcgagtcgcacgacagacactgttggcacgctggat
acagcctatcttccaggtgaaaatgatggttatattgattggaatgttattggcggctac
ggcttgaaaccacatacaccggggcaatatcaaccaaccgttccatcaacaccaaatcat
gtagatgatgttatttcttttgaagtctcttttgacggccatctcgttattaaatctgtc
aaagtaaataataacgactccgccggtcaaaatggtcaatcaggaaattcaaacgggtct
cttaatgtttcctttaatgtctctgcgggcggaaatatttctgtcaaatctactcaaaaa
tcaattaataaaacgaaagaaacaaagaaagctcatcatgtttcaacaaaaaagaaacag
aaaaaaggaaattctttctttacagctttattagctcttttcagtgctttctgcgtaagc
attggttttaaataa

DBGET integrated database retrieval system