KEGG   Streptomyces sp. Mg1: M444_29905
Entry
M444_29905        CDS       T03958                                 

Definition
(GenBank) macrocin-O-methyltransferase
  KO
K15996  macrocin O-methyltransferase [EC:2.1.1.101]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00522  Biosynthesis of 12-, 14- and 16-membered macrolides
strm01100  Metabolic pathways
strm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    M444_29905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:strm01008]
    M444_29905
Enzymes [BR:strm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.101  macrocin O-methyltransferase
     M444_29905
Polyketide biosynthesis proteins [BR:strm01008]
 Polyketide tailoring proteins
  Methylase
   M444_29905
Motif
Pfam: TylF Methyltransf_24
Other DBs
NCBI-ProteinID: AKL68947
UniProt: A0A0G3URA6
Position
1:complement(6891775..6892542)
AA seq 255 aa
MTVIPADADLYLDLLKKVVTNMIYEDQTNVAGLITSSSYSAELRAVGEDFPHVAHTMVGL
KRLDNLQKCLEDVLRDGVPGDFAETGVWRGGACIFARGLFQAHGVRDRKVWVADSFQGFP
KTTEDDHQLDVDIDLGQYNEVLSIPVDVETVKRNFARYGLLDDQVRFLPGWFKDTMPTAP
IEKLAVLRLDGDSYAATREVLTSLYHKVSVGGYVIVDDYCIPACRQAVHEFRDEHGITDE
IHQIDRQGSYWRRSS
NT seq 768 nt   +upstreamnt  +downstreamnt
atgacagtcatacctgccgacgcagacctgtatctcgaccttctgaagaaggtcgtgacg
aacatgatttacgaggaccagaccaatgtcgccggcctcatcacgagcagttcgtattcc
gcggagctgcgcgcggtgggtgaggacttcccgcacgtcgcgcacacgatggtcggtctc
aagcggctcgacaacctacagaagtgccttgaggacgtgctgcgcgacggcgtgccgggg
gacttcgcggagaccggggtctggcggggcggggcgtgcatcttcgcccgcggcctcttc
caggcgcacggcgtgcgggaccggaaggtgtgggtggcggactccttccagggtttcccc
aagaccaccgaggacgaccaccagctggacgtcgacatcgacctcggccagtacaacgaa
gtcctcagcatcccggtcgatgtggagaccgtgaaaagaaacttcgcacgctatgggctc
ctggacgaccaggtccggttcctccccggctggttcaaggacacgatgcccaccgcgccc
atcgagaagctcgcggtgctgaggctcgacggggactcgtacgcagccaccagggaggtt
ctcacgagcctctatcacaaggtgtcggtcggcgggtacgtcatcgtcgacgactactgc
attccggcgtgccggcaggccgtccacgagttccgggacgagcacggcatcacggacgag
atccaccagatcgatcgccagggttcctactggagacgctccagctga

DBGET integrated database retrieval system