KEGG   Streptomyces sp. PAMC 26508: F750_6859
Entry
F750_6859         CDS       T02619                                 
Name
(GenBank) putative dioxygenase
  KO
K18565  2-oxoglutarate-dependent dioxygenase [EC:1.14.20.-]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00332  Carbapenem biosynthesis
strp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    F750_6859
Enzymes [BR:strp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.-
     F750_6859
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-ProteinID: AGJ59283
Position
complement(7298990..7299781)
AA seq 263 aa
MRLGRPVEDIVRELDENGFAPLDDLVPESVLEVMRRGCDDLIGRTRQMRHSSQGWQLEAE
GDGGGWAARATGREGIPGKVRVVGYAHEHSPEIAKVPGLLGLNENLVEPLHGLRGDFYNS
YLWAKPSEVGSEKPWHQDALFLKEEFYEAYEDVFTIWIAVDDAREDNGCLRFLPGSHRGS
VLQEPRGINREDLFASPHEPSLDIETLWPELTPVTLPRRPGSAVIFSAFTAHTSSANVTE
DQRRAVSYVYSLPRRPGTTGAGR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcggctcggtcggccggtggaagacattgtccgcgaactggacgagaacgggttcgcc
ccgctcgacgatctcgtccccgaatcggtcctggaggtcatgcgccgcggctgcgacgac
ctgatcggccggacccggcagatgcgccacagcagtcagggctggcagctggaggccgag
ggggacggcggcggctgggcggcccgcgcgacgggcagggaaggaattccgggcaaggta
cgggtggtgggctatgcccatgaacactccccggagatcgccaaggtgcccggactgctc
ggcctgaacgagaacctggtcgagccgctgcacggtctgcgcggcgacttctacaacagc
tacctgtgggccaagccgtcggaggtgggttcggagaagccctggcaccaggacgcgctc
ttcctcaaggaggagttctacgaggcctacgaggacgtcttcaccatctggatcgccgtg
gacgacgcccgcgaggacaacggctgtctccgcttcctgccgggatcgcaccgcgggagc
gtcctgcaggagcctcgcggcatcaaccgtgaggacctcttcgcctccccgcacgaaccg
tccctggacatcgagacgctgtggcccgagctgactccggtcaccctccccaggcgcccc
ggttcggccgtgatcttcagtgcgttcaccgcgcacacctcctccgccaacgtcaccgag
gaccagcggcgtgccgtcagttacgtctactcgctgccacgccgccccggcaccacggga
gccgggcggtga

DBGET integrated database retrieval system