KEGG   Streptomyces tsukubensis: B7R87_01750
Entry
B7R87_01750       CDS       T07155                                 

Name
(GenBank) hypothetical protein
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
stsu  Streptomyces tsukubensis
Pathway
stsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:stsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B7R87_01750
Enzymes [BR:stsu01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     B7R87_01750
SSDB
Other DBs
NCBI-ProteinID: AZK92763
UniProt: A0A5H2UDB5
Position
657259..658251
AA seq 330 aa
MPVAAPYCRFEKLVPSDLEGDETVLGVIEHGTGHAEVSLTDGVPRAAVHTTTFEEEAFAE
VWRAQPPVESGRDGGIAWARTDEYLFGVGRVPESRGYADAVAALYTRVFGLTRSLGHPLL
ARTWNYISGINAANADGLEVYRDFCVGRAQALDAGGIDPAGLPAATGIGTHGGGITCVFL
AARGGTRINIENPAVLTAHHYPTAYGPRPPVFARATWLGPPGDGRLFVSATAGILGHETT
HHGDVTGQCEVALDNIARVVAAENLHRHGVRRGYALTDVDHLKVYVRRRADLPAVRRVCA
ARLASTATVAFLHTDIARGDLLVEIEGVVS
NT seq 993 nt   +upstreamnt  +downstreamnt
gtgcctgtcgcggcaccgtactgccgcttcgagaagctcgtgccgtcggacctcgaaggg
gacgagaccgtgctcggcgtcatcgagcacggcaccggtcatgccgaggtgtcgctcacg
gacggtgtcccgcgtgccgcggtgcacaccacgaccttcgaggaggaggcgttcgccgag
gtgtggcgcgcgcagccgcccgtcgagtccggccgggacggaggcatcgcatgggcccgc
accgacgagtacctgttcggtgtcggccgcgtccccgagagccgggggtacgccgatgcc
gtcgcggcgctctacacgcgggtcttcgggctgacccggtccctgggacatccgctgctc
gcccggacgtggaactacatcagtgggatcaacgcggcgaacgcggacgggctggaggtg
taccgggacttctgcgtgggccgtgcgcaggcgctggacgcgggcgggatcgacccggcc
ggcctgcccgcggccaccggcatcggcacgcacgggggtggtatcacctgcgtgttcctc
gccgcccgcggcggaacccggatcaacatcgagaaccctgccgtcctcacggcacaccac
taccccacggcgtacggcccgcgccccccggtcttcgcacgggccacctggctgggcccg
ccgggcgacggccggctgttcgtgtccgcgacggccggaatcctcgggcacgagaccacg
caccacggtgatgtgaccggtcagtgcgaggtcgccctggacaacatcgcccgggtcgtg
gccgccgagaacctgcaccggcacggtgtccggcggggttacgccctcaccgacgtcgat
cacctcaaggtctacgtccggcgccgcgcggacctccccgcggtccgccgggtctgcgcc
gcccgcttggcgagcaccgcgaccgtcgcgtttctgcacaccgacatcgcccgtggcgac
ctgctcgtggagatcgaaggagtggtgtcgtga

DBGET integrated database retrieval system