KEGG   Streptomyces violaceoruber: B1H20_29845
Entry
B1H20_29845       CDS       T05124                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K13330  dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase [EC:2.1.1.324]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00523  Polyketide sugar unit biosynthesis
svu01100  Metabolic pathways
svu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    B1H20_29845
Enzymes [BR:svu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.324  dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase
     B1H20_29845
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 MetW NodS Ubie_methyltran
Other DBs
NCBI-ProteinID: ARF65144
UniProt: A0A1V0UIV3
Position
complement(6846392..6847189)
AA seq 265 aa
MTTSPPRTEHTPDHVPAPDAQHADEGAGTAYSARHAEIYDHIHAARGRDWDAEADAVARL
VFERRPGARSVLDVACGTGAHLRRLREHFPVAEGLELSGTMREIAAARLPGSTVHRGDMR
DFDLGTEYDAVLCMCFSMGYMASTVELAAAARSLARALAPGGVVVAEPWWFPEHFLDGFV
TGSVAESDGLVVSRVSRSVREGRRSLMTVRYTVADRAGLRAFTELETYSLFTHEEYTAAF
TAAGLDTTYLPGPPNGRGLYVGVRT
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaccacctctccgccccgtacggagcacaccccggaccacgtccccgccccggacgcc
cagcacgcggacgagggcgccgggaccgcgtacagcgcccggcacgccgagatctacgac
cacatccacgccgcccggggccgtgactgggacgccgaggccgacgccgtcgcccgcctg
gtgttcgagcggcgccccggcgcacgttcggtgctggacgtggcgtgcggcaccggcgcc
catctgcggcggctgcgcgagcacttccccgtcgccgaggggctggagctgtccggcacc
atgcgggagatcgccgccgcccgcctccccggcagcacggtccaccggggcgacatgcgc
gacttcgacctcggcacggagtacgacgccgtgctgtgcatgtgcttctccatggggtac
atggcgtccacggtggaactggcggccgccgcacggtcgttggcccgcgctctggcaccg
ggcggcgtggtggtcgccgaaccctggtggttccccgagcactttctcgacgggttcgtc
acgggcagcgtcgcggagtccgacggcctcgtcgtcagccgggtctcccggtcggtgcgg
gagggccggcgctcgctgatgaccgtgcggtacacggtcgccgaccgggccgggctgcgt
gccttcaccgagctggagacgtactccctgttcacccacgaggagtacacggccgcgttc
accgccgccgggctcgacaccacgtacctgcccggtccgcccaacggacgggggctctac
gtcggggtgcggacgtga

DBGET integrated database retrieval system